close

SimulationCraft 720-01

for World of Warcraft 7.2.0 Live (wow build level 23826)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-12-18 Incorrect spell level for starfall damage component.
Starfall spell_level 40.00 76.00

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-02-04 Manually set Flurry's travel speed.
Flurry prj_speed 45.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Monk

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-03-24 Windwalker Monks now deal 8% more damage with Tiger Palm, Blackout Kick, and Rising Sun Kick.
Windwalker Monk (effect#6) base_value 8.00 8.00

Current simulator-wide DBC data overrides

Spell / Effect Field Override Value DBC Value
Rend Soul proc_chance 4.00 12.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Baseline : 895676 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
895675.5 895675.5 1397.7 / 0.156% 200597.9 / 22.4% 29.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
28222.3 28222.3 Mana 0.00% 32.4 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Baseline 895676
Agony 129409 14.5% 17.3 18.09sec 2245597 1821129 Periodic 189.2 139561 369438 205027 28.5% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.28 0.00 189.22 189.22 1.2331 1.5812 38795514.69 38795514.69 0.00 121052.14 1821129.17
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.3 71.52% 139560.83 13198 233860 139594.14 122971 156922 18886301 18886301 0.00
crit 53.9 28.48% 369437.75 30619 617389 369356.44 294825 438470 19909213 19909213 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 6208 0.7% 25.1 11.78sec 74128 0 Direct 25.1 60804 121951 74126 21.8%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.10 25.10 0.00 0.00 0.0000 0.0000 1860523.04 1860523.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.63 78.21% 60804.04 19678 189612 60987.88 37979 92423 1193659 1193659 0.00
crit 5.47 21.79% 121950.82 39356 379224 122256.94 0 321377 666864 666864 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 113215 12.6% 21.9 13.85sec 1546906 1283169 Periodic 188.8 122318 322954 179731 28.6% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 0.00 188.82 188.82 1.2056 1.5774 33937244.40 33937244.40 0.00 104652.20 1283168.65
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 134.8 71.38% 122317.79 184 200777 122375.84 108049 136252 16486983 16486983 0.00
crit 54.0 28.62% 322954.02 931 530050 322988.28 255520 386853 17450261 17450261 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 114287 12.8% 64.1 4.63sec 534263 187193 Periodic 217.4 121763 245964 157604 28.9% 56.9%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.12 0.00 217.36 217.36 2.8541 0.7852 34257918.19 34257918.19 0.00 187192.53 187192.53
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 154.6 71.14% 121762.65 78221 159277 121833.39 109820 131394 18828301 18828301 0.00
crit 62.7 28.86% 245964.40 156441 318553 246031.31 221389 266546 15429617 15429617 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 23682 2.6% 49.5 5.93sec 143337 0 Direct 49.3 118477 236824 144068 21.6%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.53 49.28 0.00 0.00 0.0000 0.0000 7099648.72 7099648.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.62 78.38% 118477.42 79942 154062 118467.11 106807 130340 4576172 4576172 0.00
crit 10.66 21.62% 236823.68 159885 308124 236704.67 186090 292115 2523477 2523477 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Soul 18002 2.0% 15.8 17.77sec 342557 0 Direct 15.8 281547 561245 342584 21.8%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.76 15.76 0.00 0.00 0.0000 0.0000 5397588.24 5397588.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.32 78.19% 281546.53 184480 355523 281306.88 217541 332519 3468478 3468478 0.00
crit 3.44 21.81% 561244.77 368960 711046 537010.70 0 711046 1929111 1929111 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (413309) 0.0% (46.1%) 46.9 6.37sec 2641636 2223108

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.86 0.00 0.00 0.00 1.1883 0.0000 0.00 0.00 0.00 2223107.56 2223107.56
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 183656 20.5% 0.0 0.00sec 0 0 Periodic 108.1 305108 814877 509162 40.0% 50.8%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 108.14 108.14 0.0000 1.4090 55058917.30 55058917.30 0.00 361366.72 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.8 59.97% 305107.90 310 473974 305530.85 255771 357151 19786208 19786208 0.00
crit 43.3 40.03% 814876.83 1068 1251292 815890.62 603797 1014532 35272709 35272709 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 143618 16.0% 0.0 0.00sec 0 0 Periodic 79.2 323449 862882 542961 40.7% 36.8%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 79.23 79.23 0.0000 1.3920 43020472.41 43020472.41 0.00 390059.77 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.0 59.30% 323448.84 432 473974 324311.09 268280 388874 15197857 15197857 0.00
crit 32.2 40.70% 862881.87 507 1251292 865069.64 659275 1114578 27822615 27822615 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 80023 8.9% 0.0 0.00sec 0 0 Periodic 42.9 332806 884561 557184 40.7% 19.4%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 42.91 42.91 0.0000 1.3579 23910096.87 23910096.87 0.00 410332.88 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.5 59.33% 332805.64 272 473974 336305.05 243355 473974 8473967 8473967 0.00
crit 17.5 40.67% 884561.46 2135 1251292 892983.00 63772 1251292 15436129 15436129 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 5170 0.6% 0.0 0.00sec 0 0 Periodic 3.0 306218 819005 513929 40.5% 1.4%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 3.00 3.00 0.0000 1.4034 1543636.47 1543636.47 0.00 366224.55 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.8 59.49% 306218.42 2243 473974 141167.39 0 473974 547199 547199 0.00
crit 1.2 40.51% 819005.20 6097 1251292 352928.34 0 1251292 996437 996437 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 842 0.1% 0.0 0.00sec 0 0 Periodic 0.5 292004 776301 488128 40.5% 0.2%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.52 0.52 0.0000 1.4325 251728.93 251728.93 0.00 341096.11 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 59.50% 292004.07 2600 473974 28622.46 0 473974 89605 89605 0.00
crit 0.2 40.50% 776301.41 9866 1251292 70547.07 0 1251292 162124 162124 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 77562 / 77562
Doom Bolt 77562 8.7% 121.6 2.46sec 191242 79831 Direct 120.8 158261 316468 192469 21.6%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.59 120.82 0.00 0.00 2.3956 0.0000 23253503.83 23253503.83 0.00 79831.31 79831.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 94.70 78.38% 158261.12 131346 227391 158300.60 150585 165496 14986717 14986717 0.00
crit 26.12 21.62% 316468.18 262692 454781 316569.30 284492 354697 8266787 8266787 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Baseline
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Baseline
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Baseline
  • harmful:false
  • if_expr:
 
Life Tap 11.1 23.20sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.14 0.00 0.00 0.00 1.2257 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 12.5 24.63sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.51 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.3 154.55sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.29 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.9 0.0 15.4sec 15.4sec 78.08% 78.08% 2.1(2.1) 19.1

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.05%
  • accelerando_2:23.84%
  • accelerando_3:14.45%
  • accelerando_4:6.89%
  • accelerando_5:3.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 22.4 24.4 13.6sec 0.0sec 56.08% 56.08% 0.0(0.0) 0.0

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:29.33%
  • active_uas_2:17.23%
  • active_uas_3:9.28%
  • active_uas_4:0.20%
  • active_uas_5:0.05%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 27.3 38.7 11.0sec 4.5sec 61.38% 100.00% 2.2(2.2) 1.6

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:25.84%
  • compounding_horror_2:16.75%
  • compounding_horror_3:9.84%
  • compounding_horror_4:5.11%
  • compounding_horror_5:3.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 12.5 0.0 24.6sec 24.6sec 73.97% 73.97% 0.0(0.0) 11.6

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:73.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.5sec 68.5sec 8.81% 8.81% 0.0(0.0) 3.3

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.81%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.5 0.0 68.8sec 68.2sec 13.71% 13.71% 0.0(0.0) 3.4

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.71%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 165.3sec 0.0sec 38.38% 38.38% 0.0(0.0) 1.9

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:38.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.3 0.0 155.1sec 155.1sec 12.86% 12.86% 0.0(0.0) 2.2

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:12.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 13.2 34.2 23.6sec 6.7sec 76.12% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:23.07%
  • tormented_souls_2:18.57%
  • tormented_souls_3:13.65%
  • tormented_souls_4:9.43%
  • tormented_souls_5:5.55%
  • tormented_souls_6:3.10%
  • tormented_souls_7:1.72%
  • tormented_souls_8:0.59%
  • tormented_souls_9:0.23%
  • tormented_souls_10:0.11%
  • tormented_souls_11:0.05%
  • tormented_souls_12:0.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 5.8 42.0sec
t18_2pc_affliction 46.9 6.4sec
soul_conduit 9.4 28.7sec
souls_consumed 45.8 24.6sec

Resources

Resource Usage Type Count Total Average RPE APR
Baseline
agony Mana 17.3 570109.1 33000.0 32999.6 68.0
corruption Mana 21.9 723981.6 33000.0 33000.1 46.9
drain_soul Mana 217.4 7172919.0 33000.0 111863.9 4.8
unstable_affliction Soul Shard 46.9 46.9 1.0 1.0 2641786.9
pet - doomguard
doom_bolt Energy 121.6 4255.7 35.0 35.0 5464.1
Resource Gains Type Count Total Average Overflow
life_tap Mana 11.14 3677029.78 (48.12%) 330000.00 0.00 0.00%
agony Soul Shard 34.77 34.77 (77.74%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.59 0.59 (1.32%) 1.00 0.00 0.00%
mp5_regen Mana 346.62 3963643.13 (51.88%) 11434.99 21818.01 0.55%
soul_conduit Soul Shard 9.36 9.36 (20.93%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 196.40 4214.12 (100.00%) 21.46 117.50 2.71%
Resource RPS-Gain RPS-Loss
Health 0.00 12510.92
Mana 25468.14 28222.31
Soul Shard 0.15 0.16
Combat End Resource Mean Min Max
Mana 275553.27 42883.25 488862.71
Soul Shard 0.84 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Baseline Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Baseline Damage Per Second
Count 4999
Mean 895675.53
Minimum 718658.93
Maximum 1073806.41
Spread ( max - min ) 355147.48
Range [ ( max - min ) / 2 * 100% ] 19.83%
Standard Deviation 50421.7279
5th Percentile 815520.59
95th Percentile 981407.42
( 95th Percentile - 5th Percentile ) 165886.83
Mean Distribution
Standard Deviation 713.1422
95.00% Confidence Intervall ( 894277.79 - 897073.26 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12174
0.1 Scale Factor Error with Delta=300 21702968
0.05 Scale Factor Error with Delta=300 86811870
0.01 Scale Factor Error with Delta=300 2170296737
Priority Target DPS
Sample Data Baseline Priority Target Damage Per Second
Count 4999
Mean 895675.53
Minimum 718658.93
Maximum 1073806.41
Spread ( max - min ) 355147.48
Range [ ( max - min ) / 2 * 100% ] 19.83%
Standard Deviation 50421.7279
5th Percentile 815520.59
95th Percentile 981407.42
( 95th Percentile - 5th Percentile ) 165886.83
Mean Distribution
Standard Deviation 713.1422
95.00% Confidence Intervall ( 894277.79 - 897073.26 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12174
0.1 Scale Factor Error with Delta=300 21702968
0.05 Scale Factor Error with Delta=300 86811870
0.01 Scale Factor Error with Delta=300 2170296737
DPS(e)
Sample Data Baseline Damage Per Second (Effective)
Count 4999
Mean 895675.53
Minimum 718658.93
Maximum 1073806.41
Spread ( max - min ) 355147.48
Range [ ( max - min ) / 2 * 100% ] 19.83%
Damage
Sample Data Baseline Damage
Count 4999
Mean 245133289.26
Minimum 174903938.55
Maximum 329838343.56
Spread ( max - min ) 154934405.01
Range [ ( max - min ) / 2 * 100% ] 31.60%
DTPS
Sample Data Baseline Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Baseline Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Baseline Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Baseline Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Baseline Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Baseline Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BaselineTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Baseline Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 1.45 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 4.55 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
D 2.29 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
E 0.96 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 0.88 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
G 12.73 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
H 10.53 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
I 14.41 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
J 6.65 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
K 5.74 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
L 1.62 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
M 39.66 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
N 8.78 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
O 2.29 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
P 0.61 life_tap,if=mana.pct<=10
Q 48.77 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACIMMMDNQIQGMMMQNQIQGMMMNQJQMQCIMMNQHQGIMQMQQQHIGMMNQIQMQQHQCQIMOQMQGHIMQMNQMDEQJQCMMQHIQGMMMNQJQMQCHIMQMNQGIHMMOQIQGMMQJHQGMOQJQMMQQHQCIMQIGHMMMBDQJKKQCQKQFQQPQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Baseline 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Baseline 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Baseline 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.334 default I corruption Fluffy_Pillow 1088895.4/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:02.343 default M unstable_affliction Fluffy_Pillow 1072744.7/1100000: 98% mana | 3.0/5: 60% soul_shard bloodlust, accelerando(2), potion_of_prolonged_power
0:03.335 default M unstable_affliction Fluffy_Pillow 1089310.0/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, accelerando(2), potion_of_prolonged_power
0:04.327 default M unstable_affliction Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), accelerando(2), potion_of_prolonged_power
0:05.319 default D soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(3), accelerando(2), potion_of_prolonged_power
0:05.319 default N reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, active_uas(3), accelerando(2), potion_of_prolonged_power
0:05.319 default Q drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), accelerando(2), potion_of_prolonged_power
0:11.413 default I corruption Fluffy_Pillow 906241.0/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(5), potion_of_prolonged_power
0:12.357 default Q drain_soul Fluffy_Pillow 889303.9/1100000: 81% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), potion_of_prolonged_power
0:13.952 default G agony Fluffy_Pillow 849027.6/1100000: 77% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(3), potion_of_prolonged_power
0:14.980 default M unstable_affliction Fluffy_Pillow 832606.9/1100000: 76% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(3), potion_of_prolonged_power
0:16.009 default M unstable_affliction Fluffy_Pillow 849202.4/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas, potion_of_prolonged_power
0:17.038 default M unstable_affliction Fluffy_Pillow 866006.6/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas(2), accelerando(2), potion_of_prolonged_power
0:18.031 default Q drain_soul Fluffy_Pillow 882588.7/1100000: 80% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas(3), accelerando(2), potion_of_prolonged_power
0:20.917 default N reap_souls Fluffy_Pillow 799231.4/1100000: 73% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, tormented_souls, active_uas(3), accelerando(3), potion_of_prolonged_power
0:20.917 default Q drain_soul Fluffy_Pillow 799231.4/1100000: 73% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), accelerando(3), potion_of_prolonged_power
0:25.808 default I corruption Fluffy_Pillow 652033.7/1100000: 59% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(4), potion_of_prolonged_power
0:26.769 default Q drain_soul Fluffy_Pillow 635630.3/1100000: 58% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(2), compounding_horror(3), accelerando(4), potion_of_prolonged_power
0:31.467 default G agony Fluffy_Pillow 482414.3/1100000: 44% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(3), compounding_horror(4), accelerando, potion_of_prolonged_power
0:32.478 default M unstable_affliction Fluffy_Pillow 466008.2/1100000: 42% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(3), compounding_horror(4), accelerando, potion_of_prolonged_power
0:33.488 default M unstable_affliction Fluffy_Pillow 482585.7/1100000: 44% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(3), active_uas, accelerando, potion_of_prolonged_power
0:34.498 default M unstable_affliction Fluffy_Pillow 499163.2/1100000: 45% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(3), active_uas(2), accelerando, potion_of_prolonged_power
0:35.508 default N reap_souls Fluffy_Pillow 515740.7/1100000: 47% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(3), active_uas(3), accelerando, potion_of_prolonged_power
0:35.508 default Q drain_soul Fluffy_Pillow 515740.7/1100000: 47% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
0:40.370 default J corruption Fluffy_Pillow 365408.9/1100000: 33% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, compounding_horror, active_uas, accelerando(3), potion_of_prolonged_power
0:41.344 default Q drain_soul Fluffy_Pillow 345134.3/1100000: 31% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), accelerando(3), potion_of_prolonged_power
0:43.243 default M unstable_affliction Fluffy_Pillow 303511.2/1100000: 28% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), potion_of_prolonged_power
0:44.578 default Q drain_soul Fluffy_Pillow 320073.1/1100000: 29% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), active_uas, potion_of_prolonged_power
0:51.995 default C agony Fluffy_Pillow 148817.0/1100000: 14% mana | 2.0/5: 40% soul_shard tormented_souls(5), compounding_horror(4), accelerando(2), potion_of_prolonged_power
0:53.282 default I corruption Fluffy_Pillow 132349.0/1100000: 12% mana | 2.0/5: 40% soul_shard tormented_souls(6), compounding_horror(4), accelerando(2), potion_of_prolonged_power
0:54.569 default M unstable_affliction Fluffy_Pillow 115880.9/1100000: 11% mana | 2.0/5: 40% soul_shard tormented_souls(6), compounding_horror(4), accelerando(2), potion_of_prolonged_power
0:55.857 default M unstable_affliction Fluffy_Pillow 132426.7/1100000: 12% mana | 1.0/5: 20% soul_shard tormented_souls(6), active_uas, accelerando(3), potion_of_prolonged_power
0:57.125 default N reap_souls Fluffy_Pillow 148993.2/1100000: 14% mana | 0.0/5: 0% soul_shard tormented_souls(6), active_uas(2), accelerando(3), potion_of_prolonged_power
0:57.125 default Q drain_soul Fluffy_Pillow 148993.2/1100000: 14% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(3), potion_of_prolonged_power
0:59.097 default H life_tap Fluffy_Pillow 108757.5/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, active_uas(2), accelerando(3)
1:00.363 default Q drain_soul Fluffy_Pillow 455297.8/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, active_uas(2), accelerando(3)
1:07.530 default G agony Fluffy_Pillow 281295.7/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(5), accelerando
1:08.842 default I corruption Fluffy_Pillow 264860.6/1100000: 24% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(5), accelerando
1:10.152 default M unstable_affliction Fluffy_Pillow 248688.0/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(5), accelerando(2)
1:11.441 default Q drain_soul Fluffy_Pillow 265245.7/1100000: 24% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando(2)
1:13.386 default M unstable_affliction Fluffy_Pillow 224229.9/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas, accelerando(2)
1:14.674 default Q drain_soul Fluffy_Pillow 240774.7/1100000: 22% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas(2), accelerando(2)
1:18.339 default Q drain_soul Fluffy_Pillow 155853.0/1100000: 14% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(2)
1:20.260 default Q drain_soul Fluffy_Pillow 114257.1/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas, accelerando
1:22.222 default H life_tap Fluffy_Pillow 73272.5/1100000: 7% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(2)
1:23.509 default I corruption Fluffy_Pillow 419804.5/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(2)
1:24.796 default G agony Fluffy_Pillow 403619.3/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(3)
1:26.064 default M unstable_affliction Fluffy_Pillow 387185.8/1100000: 35% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(3)
1:27.330 default M unstable_affliction Fluffy_Pillow 403963.6/1100000: 37% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas, accelerando(4)
1:28.577 default N reap_souls Fluffy_Pillow 420529.8/1100000: 38% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(2), accelerando(4)
1:28.577 default Q drain_soul Fluffy_Pillow 420529.8/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(4)
1:35.707 default I corruption Fluffy_Pillow 215493.3/1100000: 20% mana | 1.0/5: 20% soul_shard compounding_horror(2), nefarious_pact, accelerando
1:36.602 default Q drain_soul Fluffy_Pillow 193989.9/1100000: 18% mana | 1.0/5: 20% soul_shard compounding_horror(2), nefarious_pact, accelerando(2)
1:37.980 default M unstable_affliction Fluffy_Pillow 145690.8/1100000: 13% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), nefarious_pact, accelerando(2)
1:38.862 default Q drain_soul Fluffy_Pillow 157020.4/1100000: 14% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas, nefarious_pact, accelerando(2)
1:40.360 default Q drain_soul Fluffy_Pillow 110262.8/1100000: 10% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas, nefarious_pact, accelerando(2)
1:41.786 default H life_tap Fluffy_Pillow 62580.3/1100000: 6% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas, nefarious_pact, accelerando(2)
1:42.668 default Q drain_soul Fluffy_Pillow 403909.9/1100000: 37% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas, devils_due, accelerando(2)
1:44.977 default C agony Fluffy_Pillow 367455.5/1100000: 33% mana | 1.0/5: 20% soul_shard tormented_souls(3), devils_due
1:46.560 default Q drain_soul Fluffy_Pillow 354094.2/1100000: 32% mana | 1.0/5: 20% soul_shard tormented_souls(3), devils_due
1:49.924 default I corruption Fluffy_Pillow 297889.4/1100000: 27% mana | 1.0/5: 20% soul_shard tormented_souls(3), devils_due, accelerando(3)
1:51.427 default M unstable_affliction Fluffy_Pillow 284526.2/1100000: 26% mana | 1.0/5: 20% soul_shard tormented_souls(3), accelerando(3)
1:52.694 default O reap_souls Fluffy_Pillow 301079.6/1100000: 27% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas, accelerando(3)
1:52.694 default Q drain_soul Fluffy_Pillow 301079.6/1100000: 27% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando(3)
1:54.702 default M unstable_affliction Fluffy_Pillow 261386.8/1100000: 24% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, active_uas, accelerando(4)
1:55.948 default Q drain_soul Fluffy_Pillow 277939.6/1100000: 25% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(4)
2:02.945 default G agony Fluffy_Pillow 103485.3/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, accelerando
2:04.255 default H life_tap Fluffy_Pillow 87024.9/1100000: 8% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), accelerando
2:05.564 default I corruption Fluffy_Pillow 433879.5/1100000: 39% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(3)
2:06.830 default M unstable_affliction Fluffy_Pillow 417419.8/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(3)
2:08.095 default Q drain_soul Fluffy_Pillow 433947.1/1100000: 39% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas, accelerando(3)
2:10.079 default M unstable_affliction Fluffy_Pillow 393868.2/1100000: 36% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror, active_uas, accelerando(3)
2:11.346 default N reap_souls Fluffy_Pillow 410421.7/1100000: 37% mana | 1.0/5: 20% soul_shard tormented_souls(4), active_uas(2), accelerando(3)
2:11.346 default Q drain_soul Fluffy_Pillow 410421.7/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(2), accelerando(3)
2:13.230 default M unstable_affliction Fluffy_Pillow 368874.6/1100000: 34% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(2), accelerando
2:14.540 default D soul_harvest Fluffy_Pillow 385414.2/1100000: 35% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), accelerando
2:14.540 default E potion Fluffy_Pillow 385414.2/1100000: 35% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(3), accelerando
2:14.540 default Q drain_soul Fluffy_Pillow 385414.2/1100000: 35% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
2:17.401 default J corruption Fluffy_Pillow 322536.2/1100000: 29% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, compounding_horror, active_uas(2), accelerando, potion_of_prolonged_power
2:18.712 default Q drain_soul Fluffy_Pillow 306088.4/1100000: 28% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, compounding_horror(2), active_uas, accelerando, potion_of_prolonged_power
2:21.493 default C agony Fluffy_Pillow 242656.9/1100000: 22% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, compounding_horror(3), active_uas, accelerando(3), potion_of_prolonged_power
2:22.758 default M unstable_affliction Fluffy_Pillow 226184.2/1100000: 21% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, compounding_horror(4), accelerando(3), potion_of_prolonged_power
2:24.025 default M unstable_affliction Fluffy_Pillow 242832.1/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, active_uas, accelerando(4), potion_of_prolonged_power
2:25.270 default Q drain_soul Fluffy_Pillow 259155.5/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(2), potion_of_prolonged_power
2:31.720 default H life_tap Fluffy_Pillow 109462.4/1100000: 10% mana | 1.0/5: 20% soul_shard compounding_horror(2), active_uas, accelerando(2), potion_of_prolonged_power
2:33.010 default I corruption Fluffy_Pillow 456032.9/1100000: 41% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(3), accelerando(2), potion_of_prolonged_power
2:34.296 default Q drain_soul Fluffy_Pillow 439602.1/1100000: 40% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(3), accelerando(3), potion_of_prolonged_power
2:37.155 default G agony Fluffy_Pillow 378398.5/1100000: 34% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(4), accelerando(4), potion_of_prolonged_power
2:38.399 default M unstable_affliction Fluffy_Pillow 361924.8/1100000: 33% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(4), accelerando(4), potion_of_prolonged_power
2:39.645 default M unstable_affliction Fluffy_Pillow 377945.9/1100000: 34% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas, potion_of_prolonged_power
2:40.981 default M unstable_affliction Fluffy_Pillow 394520.3/1100000: 36% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas(2), potion_of_prolonged_power
2:42.316 default N reap_souls Fluffy_Pillow 411082.2/1100000: 37% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(3), potion_of_prolonged_power
2:42.316 default Q drain_soul Fluffy_Pillow 411082.2/1100000: 37% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), potion_of_prolonged_power
2:46.199 default J corruption Fluffy_Pillow 327526.7/1100000: 30% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), active_uas(3), accelerando, potion_of_prolonged_power
2:47.509 default Q drain_soul Fluffy_Pillow 311066.3/1100000: 28% mana | 0.0/5: 0% soul_shard compounding_horror(2), active_uas(2), accelerando, potion_of_prolonged_power
2:49.514 default M unstable_affliction Fluffy_Pillow 270438.5/1100000: 25% mana | 1.0/5: 20% soul_shard compounding_horror(2), accelerando(2), potion_of_prolonged_power
2:50.802 default Q drain_soul Fluffy_Pillow 286983.4/1100000: 26% mana | 0.0/5: 0% soul_shard active_uas, accelerando(2), potion_of_prolonged_power
2:57.918 default C agony Fluffy_Pillow 113970.0/1100000: 10% mana | 0.0/5: 0% soul_shard tormented_souls, compounding_horror, potion_of_prolonged_power
2:59.252 default H life_tap Fluffy_Pillow 97519.5/1100000: 9% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, potion_of_prolonged_power
3:00.586 default I corruption Fluffy_Pillow 444240.6/1100000: 40% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), accelerando, potion_of_prolonged_power
3:01.897 default M unstable_affliction Fluffy_Pillow 427792.9/1100000: 39% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), accelerando, potion_of_prolonged_power
3:03.208 default Q drain_soul Fluffy_Pillow 444346.2/1100000: 40% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas, accelerando(2), potion_of_prolonged_power
3:07.854 default M unstable_affliction Fluffy_Pillow 339025.7/1100000: 31% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror, active_uas, nefarious_pact, accelerando(2), potion_of_prolonged_power
3:08.735 default N reap_souls Fluffy_Pillow 350411.3/1100000: 32% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas(2), nefarious_pact, accelerando(3), potion_of_prolonged_power
3:08.735 default Q drain_soul Fluffy_Pillow 350411.3/1100000: 32% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), nefarious_pact, accelerando(3), potion_of_prolonged_power
3:13.553 default G agony Fluffy_Pillow 148550.9/1100000: 14% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), nefarious_pact, accelerando, potion_of_prolonged_power
3:14.450 default I corruption Fluffy_Pillow 126876.1/1100000: 12% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), nefarious_pact, accelerando, potion_of_prolonged_power
3:15.346 default H life_tap Fluffy_Pillow 105188.7/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), nefarious_pact, accelerando
3:16.243 default M unstable_affliction Fluffy_Pillow 446660.9/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(4), devils_due, accelerando(2)
3:17.773 default M unstable_affliction Fluffy_Pillow 466314.3/1100000: 42% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), active_uas, devils_due, accelerando(2)
3:19.303 default O reap_souls Fluffy_Pillow 485967.7/1100000: 44% mana | 0.0/5: 0% soul_shard tormented_souls(4), active_uas, devils_due, accelerando(2)
3:19.303 default Q drain_soul Fluffy_Pillow 485967.7/1100000: 44% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, devils_due, accelerando(2)
3:27.403 default I corruption Fluffy_Pillow 324811.3/1100000: 30% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(2)
3:28.692 default Q drain_soul Fluffy_Pillow 308431.9/1100000: 28% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(3)
3:31.439 default G agony Fluffy_Pillow 245370.8/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(4)
3:32.685 default M unstable_affliction Fluffy_Pillow 229197.4/1100000: 21% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(5)
3:33.911 default M unstable_affliction Fluffy_Pillow 245753.9/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(5)
3:35.136 default Q drain_soul Fluffy_Pillow 262296.9/1100000: 24% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas(2), accelerando(5)
3:41.253 default J corruption Fluffy_Pillow 110914.2/1100000: 10% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror, active_uas, accelerando
3:42.561 default H life_tap Fluffy_Pillow 94629.2/1100000: 9% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror, accelerando(2)
3:43.850 default Q drain_soul Fluffy_Pillow 441254.1/1100000: 40% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror(2), accelerando(3)
3:50.002 default G agony Fluffy_Pillow 291427.7/1100000: 26% mana | 2.0/5: 40% soul_shard tormented_souls(3), compounding_horror(2), accelerando(4)
3:51.248 default M unstable_affliction Fluffy_Pillow 274980.5/1100000: 25% mana | 2.0/5: 40% soul_shard tormented_souls(3), compounding_horror(2), accelerando(4)
3:52.493 default O reap_souls Fluffy_Pillow 291104.4/1100000: 26% mana | 1.0/5: 20% soul_shard tormented_souls(3), active_uas
3:52.493 default Q drain_soul Fluffy_Pillow 291104.4/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas
3:55.341 default J corruption Fluffy_Pillow 227478.2/1100000: 21% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando
3:56.652 default Q drain_soul Fluffy_Pillow 211030.5/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando
3:58.734 default M unstable_affliction Fluffy_Pillow 171774.5/1100000: 16% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas, accelerando(2)
4:00.024 default M unstable_affliction Fluffy_Pillow 188345.0/1100000: 17% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(2)
4:01.313 default Q drain_soul Fluffy_Pillow 204902.7/1100000: 19% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas(2), accelerando(2)
4:04.929 default Q drain_soul Fluffy_Pillow 120097.6/1100000: 11% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas(2), accelerando(4)
4:06.729 default H life_tap Fluffy_Pillow 78405.7/1100000: 7% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas(2), accelerando(5)
4:07.955 default Q drain_soul Fluffy_Pillow 424079.0/1100000: 39% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, active_uas
4:09.958 default C agony Fluffy_Pillow 383368.2/1100000: 35% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, accelerando
4:11.269 default I corruption Fluffy_Pillow 367039.7/1100000: 33% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), accelerando(2)
4:12.557 default M unstable_affliction Fluffy_Pillow 350584.5/1100000: 32% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), accelerando(2)
4:13.846 default Q drain_soul Fluffy_Pillow 367143.3/1100000: 33% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas, accelerando(3)
4:23.347 default I corruption Fluffy_Pillow 126648.2/1100000: 12% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror(2), accelerando
4:24.659 default G agony Fluffy_Pillow 110213.1/1100000: 10% mana | 2.0/5: 40% soul_shard tormented_souls(6), compounding_horror(2), accelerando
4:25.969 default H life_tap Fluffy_Pillow 93752.7/1100000: 9% mana | 2.0/5: 40% soul_shard tormented_souls(6), compounding_horror(2), accelerando
4:27.280 default M unstable_affliction Fluffy_Pillow 440304.9/1100000: 40% mana | 2.0/5: 40% soul_shard tormented_souls(6), compounding_horror(2), accelerando
4:28.590 default M unstable_affliction Fluffy_Pillow 456845.4/1100000: 42% mana | 1.0/5: 20% soul_shard tormented_souls(6), active_uas, accelerando(2)
4:29.879 default M unstable_affliction Fluffy_Pillow 473403.1/1100000: 43% mana | 1.0/5: 20% soul_shard tormented_souls(6), active_uas(2), accelerando(2)
4:31.166 default B reap_souls Fluffy_Pillow 489935.0/1100000: 45% mana | 0.0/5: 0% soul_shard tormented_souls(6), active_uas(3), accelerando(2)
4:31.166 default D soul_harvest Fluffy_Pillow 489935.0/1100000: 45% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), accelerando(2)
4:31.166 default Q drain_soul Fluffy_Pillow 489935.0/1100000: 45% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(3), accelerando(2)
4:37.483 default J corruption Fluffy_Pillow 338181.1/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, active_uas, accelerando
4:38.795 default K unstable_affliction Fluffy_Pillow 321746.0/1100000: 29% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, accelerando
4:40.105 default K unstable_affliction Fluffy_Pillow 338285.6/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls, active_uas, accelerando
4:41.415 default Q drain_soul Fluffy_Pillow 354826.1/1100000: 32% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls, active_uas(2), accelerando(2)
4:45.936 default C agony Fluffy_Pillow 248953.7/1100000: 23% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), active_uas, accelerando(4)
4:47.183 default Q drain_soul Fluffy_Pillow 232588.8/1100000: 21% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror(2), accelerando(5)
4:49.086 default K unstable_affliction Fluffy_Pillow 191426.5/1100000: 17% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(3)
4:50.422 default Q drain_soul Fluffy_Pillow 208000.9/1100000: 19% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), active_uas
4:52.467 default F corruption Fluffy_Pillow 167459.6/1100000: 15% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), active_uas, accelerando
4:53.780 default Q drain_soul Fluffy_Pillow 151037.1/1100000: 14% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), active_uas, accelerando
4:55.816 default Q drain_soul Fluffy_Pillow 110998.9/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror, active_uas, accelerando(2)
4:57.723 default P life_tap Fluffy_Pillow 69495.0/1100000: 6% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(2), accelerando(2)
4:59.011 default Q drain_soul Fluffy_Pillow 416039.8/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(6), compounding_horror(3), accelerando(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 55168 55168 34531
Intellect 50513 48806 39155 (1278)
Spirit 0 0 0
Health 3310080 3310080 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50513 48806 0
Crit 21.61% 21.61% 6645
Haste 12.78% 12.78% 4793
Damage / Heal Versatility 2.33% 2.33% 1107
ManaReg per Second 12406 12406 0
Mastery 121.41% 118.41% 11956
Armor 1983 1983 1983
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 905, stats: { 257 Armor, +3410 Sta, +2273 Int, +1094 Haste, +589 Vers }
Local Neck Beleron's Choker of Misery
ilevel: 905, stats: { +1918 Sta, +1727 Crit, +1295 Mastery }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Master Warmage's Leggings
ilevel: 905, stats: { 277 Armor, +3410 Sta, +2273 Int, +914 Mastery, +769 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Bracers of Harnessed Flame
ilevel: 905, stats: { 139 Armor, +1918 Sta, +1278 Int, +595 Mastery, +351 Crit }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Spellblade's Gemmed Signet
ilevel: 905, stats: { +1918 Sta, +2073 Crit, +950 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Temporal Recalibration
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +636 Mastery, +311 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Baseline"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3518
neck=belerons_choker_of_misery,id=140899,bonus_id=3518,enchant=mark_of_the_trained_soldier
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518
back=cloak_of_temporal_recalibration,id=140910,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3518
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518
legs=master_warmages_leggings,id=140852,bonus_id=3518
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=spellblades_gemmed_signet,id=140895,bonus_id=3518,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=erratic_metronome,id=140792,bonus_id=3445
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=907.27
# gear_stamina=34531
# gear_intellect=39155
# gear_crit_rating=6515
# gear_haste_rating=4699
# gear_mastery_rating=11722
# gear_versatility_rating=1085
# gear_armor=1983
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Celumbra_the_Nights_Dichotomy : 924087 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
924086.7 924086.7 1428.6 / 0.155% 203411.8 / 22.0% 29.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
28753.8 28753.8 Mana 0.00% 32.7 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Celumbra_the_Nights_Dichotomy 924087
Agony 133744 14.5% 17.3 18.10sec 2321545 1916768 Periodic 192.9 138720 367324 207827 30.2% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.27 0.00 192.94 192.94 1.2112 1.5507 40098788.20 40098788.20 0.00 125266.04 1916768.08
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 134.6 69.77% 138720.36 13078 231744 138745.29 120069 158241 18673160 18673160 0.00
crit 58.3 30.23% 367324.43 30342 611805 367250.44 288969 435285 21425629 21425629 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 6483 0.7% 25.7 11.56sec 75667 0 Direct 25.7 61434 122865 75670 23.2%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.68 25.68 0.00 0.00 0.0000 0.0000 1942801.13 1942801.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.73 76.83% 61434.31 19739 190071 61612.95 36826 93619 1211902 1211902 0.00
crit 5.95 23.17% 122865.35 39477 380142 123208.25 0 319470 730899 730899 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 116791 12.6% 21.9 13.85sec 1595798 1347691 Periodic 192.5 121678 321117 181900 30.2% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 0.00 192.45 192.45 1.1841 1.5478 35007631.84 35007631.84 0.00 108097.29 1347691.40
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 134.3 69.80% 121677.94 120 198962 121726.39 106588 133960 16346163 16346163 0.00
crit 58.1 30.20% 321116.60 2478 525259 321120.08 258414 380340 18661469 18661469 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 118755 12.9% 65.2 4.56sec 546125 193735 Periodic 222.2 122261 246799 160214 30.5% 57.1%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.18 0.00 222.20 222.20 2.8189 0.7709 35598869.75 35598869.75 0.00 193735.35 193735.35
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 154.5 69.53% 122260.63 78462 159662 122331.01 110585 131803 18888065 18888065 0.00
crit 67.7 30.47% 246799.44 156925 319325 246868.13 219076 269368 16710805 16710805 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 24608 2.7% 50.6 5.81sec 145840 0 Direct 50.3 118959 237907 146545 23.2%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.57 50.33 0.00 0.00 0.0000 0.0000 7375397.85 7375397.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.66 76.81% 118959.08 80189 154435 118951.57 107456 131107 4598550 4598550 0.00
crit 11.67 23.19% 237906.51 160379 308870 237930.98 191633 285312 2776848 2776848 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Soul 18867 2.0% 16.2 17.27sec 348194 0 Direct 16.2 282069 564654 348210 23.4%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.24 16.24 0.00 0.00 0.0000 0.0000 5652946.66 5652946.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.44 76.60% 282069.15 185049 356384 281783.37 233704 341534 3507732 3507732 0.00
crit 3.80 23.40% 564653.88 370099 712767 547921.56 0 712767 2145214 2145214 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (424504) 0.0% (45.9%) 47.7 6.27sec 2662646 2280235

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.74 0.00 0.00 0.00 1.1677 0.0000 0.00 0.00 0.00 2280235.02 2280235.02
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 188318 20.4% 0.0 0.00sec 0 0 Periodic 109.9 303319 808308 513758 41.7% 50.7%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 109.88 109.88 0.0000 1.3842 56453749.93 56453749.93 0.00 371169.38 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.1 58.32% 303319.21 143 469690 303725.10 246543 358337 19437537 19437537 0.00
crit 45.8 41.68% 808308.11 372 1239982 809209.92 645579 1009725 37016213 37016213 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 147138 15.9% 0.0 0.00sec 0 0 Periodic 80.6 322132 854552 546634 42.2% 36.8%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 80.64 80.64 0.0000 1.3692 44080276.21 44080276.21 0.00 399212.78 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.6 57.84% 322132.15 211 469690 322993.76 257539 390102 15024006 15024006 0.00
crit 34.0 42.16% 854551.97 487 1239982 856710.94 644492 1063193 29056270 29056270 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 82708 8.9% 0.0 0.00sec 0 0 Periodic 44.0 330418 879395 561836 42.2% 19.6%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 43.97 43.97 0.0000 1.3375 24706479.81 24706479.81 0.00 420056.78 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.4 57.85% 330418.04 207 469690 333768.97 207883 469690 8405219 8405219 0.00
crit 18.5 42.15% 879394.61 1429 1239982 887208.59 370569 1239982 16301261 16301261 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 5422 0.6% 0.0 0.00sec 0 0 Periodic 3.1 303926 809742 518769 42.5% 1.4%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 3.11 3.11 0.0000 1.3812 1611577.19 1611577.19 0.00 375659.02 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.8 57.53% 303926.07 1328 469690 145227.07 0 469690 543140 543140 0.00
crit 1.3 42.47% 809742.10 3369 1239982 366080.26 0 1239982 1068437 1068437 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 917 0.1% 0.0 0.00sec 0 0 Periodic 0.6 291975 759592 485252 41.3% 0.3%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.56 0.56 0.0000 1.4142 271019.09 271019.09 0.00 343496.95 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 58.67% 291975.37 751 469690 30785.28 0 469690 95670 95670 0.00
crit 0.2 41.33% 759591.66 3939 1239982 75617.73 0 1239982 175349 175349 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 80336 / 80336
Doom Bolt 80336 8.7% 123.8 2.41sec 194476 82680 Direct 123.1 158939 317722 195731 23.2%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.85 123.05 0.00 0.00 2.3522 0.0000 24085224.77 24085224.77 0.00 82679.87 82679.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 94.54 76.83% 158939.41 131751 227941 158976.35 150746 166853 15026934 15026934 0.00
crit 28.51 23.17% 317721.97 263503 455882 317806.57 291199 350624 9058291 9058291 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Celumbra_the_Nights_Dichotomy
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Celumbra_the_Nights_Dichotomy
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Celumbra_the_Nights_Dichotomy
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Celumbra_the_Nights_Dichotomy
  • harmful:false
  • if_expr:
 
Life Tap 11.4 22.77sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.40 0.00 0.00 0.00 1.2023 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 12.4 24.90sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.42 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.3 154.22sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.29 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.8 0.0 15.5sec 15.5sec 77.81% 77.81% 2.1(2.1) 19.1

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.07%
  • accelerando_2:23.63%
  • accelerando_3:14.44%
  • accelerando_4:6.86%
  • accelerando_5:3.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 22.7 25.0 13.4sec 0.0sec 56.01% 56.01% 0.0(0.0) 0.0

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:29.09%
  • active_uas_2:17.28%
  • active_uas_3:9.40%
  • active_uas_4:0.20%
  • active_uas_5:0.05%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 27.8 39.9 10.8sec 4.4sec 61.64% 100.00% 2.3(2.3) 1.6

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:25.72%
  • compounding_horror_2:16.86%
  • compounding_horror_3:9.96%
  • compounding_horror_4:5.17%
  • compounding_horror_5:3.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 12.4 0.0 24.8sec 24.8sec 74.69% 74.69% 0.0(0.0) 11.5

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:74.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.9sec 68.9sec 8.74% 8.74% 0.0(0.0) 3.2

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.5 0.0 69.2sec 68.3sec 13.60% 13.60% 0.0(0.0) 3.3

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 164.2sec 0.0sec 38.46% 38.46% 0.0(0.0) 1.9

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:38.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.3 0.0 154.1sec 154.1sec 12.88% 12.88% 0.0(0.0) 2.3

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:12.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 13.1 34.9 23.7sec 6.6sec 76.31% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:22.75%
  • tormented_souls_2:18.31%
  • tormented_souls_3:13.52%
  • tormented_souls_4:9.71%
  • tormented_souls_5:5.71%
  • tormented_souls_6:3.28%
  • tormented_souls_7:1.87%
  • tormented_souls_8:0.65%
  • tormented_souls_9:0.29%
  • tormented_souls_10:0.12%
  • tormented_souls_11:0.06%
  • tormented_souls_12:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 6.0 41.1sec
t18_2pc_affliction 47.7 6.3sec
soul_conduit 9.5 28.3sec
souls_consumed 46.3 24.8sec

Resources

Resource Usage Type Count Total Average RPE APR
Celumbra_the_Nights_Dichotomy
agony Mana 17.3 569983.8 33000.0 32999.6 70.4
corruption Mana 21.9 723935.4 33000.0 33000.1 48.4
drain_soul Mana 222.2 7332582.9 33000.0 112489.8 4.9
unstable_affliction Soul Shard 47.7 47.7 1.0 1.0 2662757.1
pet - doomguard
doom_bolt Energy 123.8 4334.6 35.0 35.0 5556.5
Resource Gains Type Count Total Average Overflow
life_tap Mana 11.40 3760931.44 (48.21%) 330000.00 0.00 0.00%
agony Soul Shard 35.54 35.54 (77.90%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.59 0.59 (1.30%) 1.00 0.00 0.00%
mp5_regen Mana 351.00 4039642.91 (51.79%) 11508.79 21958.48 0.54%
soul_conduit Soul Shard 9.49 9.49 (20.79%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 198.63 4293.25 (100.00%) 21.61 120.33 2.73%
Resource RPS-Gain RPS-Loss
Health 0.00 13104.66
Mana 26000.71 28753.83
Soul Shard 0.15 0.16
Combat End Resource Mean Min Max
Mana 282399.87 45376.53 495463.42
Soul Shard 0.86 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Celumbra_the_Nights_Dichotomy Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Celumbra_the_Nights_Dichotomy Damage Per Second
Count 4999
Mean 924086.66
Minimum 721495.23
Maximum 1128511.77
Spread ( max - min ) 407016.53
Range [ ( max - min ) / 2 * 100% ] 22.02%
Standard Deviation 51535.8511
5th Percentile 842002.67
95th Percentile 1010949.20
( 95th Percentile - 5th Percentile ) 168946.53
Mean Distribution
Standard Deviation 728.8999
95.00% Confidence Intervall ( 922658.04 - 925515.28 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 120
0.1% Error 11948
0.1 Scale Factor Error with Delta=300 22672666
0.05 Scale Factor Error with Delta=300 90690661
0.01 Scale Factor Error with Delta=300 2267266518
Priority Target DPS
Sample Data Celumbra_the_Nights_Dichotomy Priority Target Damage Per Second
Count 4999
Mean 924086.66
Minimum 721495.23
Maximum 1128511.77
Spread ( max - min ) 407016.53
Range [ ( max - min ) / 2 * 100% ] 22.02%
Standard Deviation 51535.8511
5th Percentile 842002.67
95th Percentile 1010949.20
( 95th Percentile - 5th Percentile ) 168946.53
Mean Distribution
Standard Deviation 728.8999
95.00% Confidence Intervall ( 922658.04 - 925515.28 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 120
0.1% Error 11948
0.1 Scale Factor Error with Delta=300 22672666
0.05 Scale Factor Error with Delta=300 90690661
0.01 Scale Factor Error with Delta=300 2267266518
DPS(e)
Sample Data Celumbra_the_Nights_Dichotomy Damage Per Second (Effective)
Count 4999
Mean 924086.66
Minimum 721495.23
Maximum 1128511.77
Spread ( max - min ) 407016.53
Range [ ( max - min ) / 2 * 100% ] 22.02%
Damage
Sample Data Celumbra_the_Nights_Dichotomy Damage
Count 4999
Mean 252799537.66
Minimum 175380987.09
Maximum 344440637.98
Spread ( max - min ) 169059650.89
Range [ ( max - min ) / 2 * 100% ] 33.44%
DTPS
Sample Data Celumbra_the_Nights_Dichotomy Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Celumbra_the_Nights_Dichotomy Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Celumbra_the_Nights_Dichotomy Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Celumbra_the_Nights_Dichotomy Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Celumbra_the_Nights_Dichotomy Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Celumbra_the_Nights_Dichotomy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Celumbra_the_Nights_DichotomyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Celumbra_the_Nights_Dichotomy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 1.51 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 4.38 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
D 2.29 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
E 0.96 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 0.79 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
G 12.90 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
H 10.78 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
I 14.72 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
J 6.43 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
K 5.82 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
L 1.71 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
M 40.38 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
N 8.71 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
O 2.20 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
P 0.62 life_tap,if=mana.pct<=10
Q 49.28 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACIMMMDNQIQGMMQIQGMMMNQJQMQQCHIMMQGIMOQMQMQHQFQGQMQJQHQGMOQJQMMQNQCHIMMNQIGMMNQHQIQGMMMDENQJQMMQGHIQMQQHGIMOQMQJQGHMQJQGMOQHQJMQGQIMOQHQMQFGHQKQBFKQCKQPJQKQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Celumbra_the_Nights_Dichotomy 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Celumbra_the_Nights_Dichotomy 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Celumbra_the_Nights_Dichotomy 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.308 default I corruption Fluffy_Pillow 1088887.1/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:02.300 default M unstable_affliction Fluffy_Pillow 1072486.6/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:03.289 default M unstable_affliction Fluffy_Pillow 1089035.8/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, accelerando, potion_of_prolonged_power
0:04.279 default M unstable_affliction Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), accelerando, potion_of_prolonged_power
0:05.270 default D soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(3), accelerando, potion_of_prolonged_power
0:05.270 default N reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, active_uas(3), accelerando, potion_of_prolonged_power
0:05.270 default Q drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
0:11.405 default I corruption Fluffy_Pillow 907589.2/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror, accelerando(3), potion_of_prolonged_power
0:12.363 default Q drain_soul Fluffy_Pillow 890855.8/1100000: 81% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror, potion_of_prolonged_power
0:13.909 default G agony Fluffy_Pillow 850283.3/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror, potion_of_prolonged_power
0:14.918 default M unstable_affliction Fluffy_Pillow 833878.6/1100000: 76% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror(3), potion_of_prolonged_power
0:15.927 default M unstable_affliction Fluffy_Pillow 850545.1/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), active_uas, accelerando, potion_of_prolonged_power
0:16.916 default Q drain_soul Fluffy_Pillow 867094.3/1100000: 79% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), active_uas(2), accelerando, potion_of_prolonged_power
0:25.822 default I corruption Fluffy_Pillow 588456.3/1100000: 53% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(5), compounding_horror, accelerando(3), potion_of_prolonged_power
0:26.778 default Q drain_soul Fluffy_Pillow 572272.5/1100000: 52% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(5), compounding_horror(2), accelerando(4), potion_of_prolonged_power
0:31.434 default G agony Fluffy_Pillow 419689.3/1100000: 38% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(6), compounding_horror(2), accelerando, potion_of_prolonged_power
0:32.423 default M unstable_affliction Fluffy_Pillow 403238.5/1100000: 37% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(6), compounding_horror(2), accelerando, potion_of_prolonged_power
0:33.414 default M unstable_affliction Fluffy_Pillow 419821.2/1100000: 38% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(6), active_uas, accelerando, potion_of_prolonged_power
0:34.403 default M unstable_affliction Fluffy_Pillow 436525.8/1100000: 40% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(6), active_uas(2), accelerando(2), potion_of_prolonged_power
0:35.377 default N reap_souls Fluffy_Pillow 453102.2/1100000: 41% mana | 0.0/5: 0% soul_shard bloodlust, tormented_souls(6), active_uas(3), accelerando(2), potion_of_prolonged_power
0:35.377 default Q drain_soul Fluffy_Pillow 453102.2/1100000: 41% mana | 0.0/5: 0% soul_shard bloodlust, deadwind_harvester, active_uas(3), accelerando(2), potion_of_prolonged_power
0:40.114 default J corruption Fluffy_Pillow 302720.7/1100000: 28% mana | 0.0/5: 0% soul_shard bloodlust, deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, accelerando(2), potion_of_prolonged_power
0:41.087 default Q drain_soul Fluffy_Pillow 284166.4/1100000: 26% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), potion_of_prolonged_power
0:43.071 default M unstable_affliction Fluffy_Pillow 243267.5/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(3), potion_of_prolonged_power
0:44.380 default Q drain_soul Fluffy_Pillow 259828.7/1100000: 24% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, potion_of_prolonged_power
0:50.769 default Q drain_soul Fluffy_Pillow 111650.4/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, accelerando(2), potion_of_prolonged_power
0:52.732 default C agony Fluffy_Pillow 71348.9/1100000: 6% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:53.996 default H life_tap Fluffy_Pillow 54896.5/1100000: 5% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:55.261 default I corruption Fluffy_Pillow 401457.2/1100000: 36% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:56.526 default M unstable_affliction Fluffy_Pillow 385017.9/1100000: 35% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), accelerando(2), potion_of_prolonged_power
0:57.790 default M unstable_affliction Fluffy_Pillow 401266.1/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas, potion_of_prolonged_power
0:59.097 default Q drain_soul Fluffy_Pillow 417802.6/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), accelerando
1:06.990 default G agony Fluffy_Pillow 223435.5/1100000: 20% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror(3), accelerando(3)
1:08.234 default I corruption Fluffy_Pillow 206994.6/1100000: 19% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror(3), accelerando(3)
1:09.478 default M unstable_affliction Fluffy_Pillow 190553.7/1100000: 17% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror(4), accelerando(3)
1:10.723 default O reap_souls Fluffy_Pillow 207184.8/1100000: 19% mana | 0.0/5: 0% soul_shard tormented_souls(5), active_uas, accelerando(4)
1:10.723 default Q drain_soul Fluffy_Pillow 207184.8/1100000: 19% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando(4)
1:13.386 default M unstable_affliction Fluffy_Pillow 142202.6/1100000: 13% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas
1:14.693 default Q drain_soul Fluffy_Pillow 158925.5/1100000: 14% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(2), accelerando(2)
1:16.598 default M unstable_affliction Fluffy_Pillow 117864.7/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas(2), accelerando(2)
1:17.862 default Q drain_soul Fluffy_Pillow 134412.3/1100000: 12% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas(2), accelerando(2)
1:19.752 default H life_tap Fluffy_Pillow 93385.9/1100000: 8% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas(2), accelerando(3)
1:20.995 default Q drain_soul Fluffy_Pillow 440019.3/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas(2), accelerando(4)
1:22.851 default F corruption Fluffy_Pillow 399132.6/1100000: 36% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas, accelerando(4)
1:24.073 default Q drain_soul Fluffy_Pillow 382717.3/1100000: 35% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), active_uas, accelerando(5)
1:25.967 default G agony Fluffy_Pillow 342627.9/1100000: 31% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5)
1:27.276 default Q drain_soul Fluffy_Pillow 326234.4/1100000: 30% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5), accelerando
1:29.338 default M unstable_affliction Fluffy_Pillow 287041.4/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), accelerando(2)
1:30.601 default Q drain_soul Fluffy_Pillow 303607.1/1100000: 28% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(3)
1:36.684 default J corruption Fluffy_Pillow 154106.0/1100000: 14% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas, accelerando(5)
1:37.887 default Q drain_soul Fluffy_Pillow 137648.0/1100000: 13% mana | 1.0/5: 20% soul_shard tormented_souls(2), accelerando(5)
1:39.745 default H life_tap Fluffy_Pillow 96454.9/1100000: 9% mana | 1.0/5: 20% soul_shard tormented_souls(2)
1:41.054 default Q drain_soul Fluffy_Pillow 443016.0/1100000: 40% mana | 1.0/5: 20% soul_shard tormented_souls(2)
1:43.033 default G agony Fluffy_Pillow 402053.8/1100000: 37% mana | 2.0/5: 40% soul_shard tormented_souls(2)
1:44.341 default M unstable_affliction Fluffy_Pillow 385602.3/1100000: 35% mana | 2.0/5: 40% soul_shard tormented_souls(2)
1:45.649 default O reap_souls Fluffy_Pillow 402194.2/1100000: 37% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas, accelerando
1:45.649 default Q drain_soul Fluffy_Pillow 402194.2/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando
1:50.144 default J corruption Fluffy_Pillow 295102.2/1100000: 27% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), active_uas, accelerando(2)
1:51.409 default Q drain_soul Fluffy_Pillow 278662.9/1100000: 25% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), active_uas, accelerando(2)
1:53.362 default M unstable_affliction Fluffy_Pillow 238230.5/1100000: 22% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), accelerando(2)
1:54.627 default M unstable_affliction Fluffy_Pillow 254791.2/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(2)
1:55.891 default Q drain_soul Fluffy_Pillow 271392.2/1100000: 25% mana | 0.0/5: 0% soul_shard active_uas(2), accelerando(3)
1:57.770 default N reap_souls Fluffy_Pillow 230446.9/1100000: 21% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas(2)
1:57.770 default Q drain_soul Fluffy_Pillow 230446.9/1100000: 21% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(2)
2:04.067 default C agony Fluffy_Pillow 79977.1/1100000: 7% mana | 1.0/5: 20% soul_shard accelerando(2)
2:05.331 default H life_tap Fluffy_Pillow 63524.8/1100000: 6% mana | 1.0/5: 20% soul_shard accelerando(2)
2:06.595 default I corruption Fluffy_Pillow 410072.4/1100000: 37% mana | 2.0/5: 40% soul_shard accelerando(2)
2:07.860 default M unstable_affliction Fluffy_Pillow 393633.1/1100000: 36% mana | 2.0/5: 40% soul_shard tormented_souls, accelerando(2)
2:09.127 default M unstable_affliction Fluffy_Pillow 410220.0/1100000: 37% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas, accelerando(2)
2:10.391 default N reap_souls Fluffy_Pillow 426767.6/1100000: 39% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(2), accelerando(2)
2:10.391 default Q drain_soul Fluffy_Pillow 426767.6/1100000: 39% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(2)
2:17.404 default I corruption Fluffy_Pillow 253543.8/1100000: 23% mana | 1.0/5: 20% soul_shard tormented_souls(3), accelerando(2)
2:18.670 default G agony Fluffy_Pillow 237117.6/1100000: 22% mana | 1.0/5: 20% soul_shard tormented_souls(3), accelerando(2)
2:19.934 default M unstable_affliction Fluffy_Pillow 220665.2/1100000: 20% mana | 1.0/5: 20% soul_shard tormented_souls(3), accelerando(2)
2:21.200 default M unstable_affliction Fluffy_Pillow 237239.0/1100000: 22% mana | 1.0/5: 20% soul_shard tormented_souls(3), active_uas, accelerando(2)
2:22.465 default N reap_souls Fluffy_Pillow 253799.7/1100000: 23% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas(2), accelerando(2)
2:22.465 default Q drain_soul Fluffy_Pillow 253799.7/1100000: 23% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(2)
2:28.742 default H life_tap Fluffy_Pillow 103963.7/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas, accelerando
2:30.028 default Q drain_soul Fluffy_Pillow 450703.1/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, accelerando(2)
2:32.002 default I corruption Fluffy_Pillow 410794.8/1100000: 37% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), accelerando(3)
2:33.246 default Q drain_soul Fluffy_Pillow 394353.9/1100000: 36% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), accelerando(3)
2:37.606 default G agony Fluffy_Pillow 287821.9/1100000: 26% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror(2), accelerando(5)
2:38.811 default M unstable_affliction Fluffy_Pillow 271391.3/1100000: 25% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror(3), accelerando(5)
2:40.014 default M unstable_affliction Fluffy_Pillow 287823.4/1100000: 26% mana | 2.0/5: 40% soul_shard tormented_souls(5), active_uas
2:41.324 default M unstable_affliction Fluffy_Pillow 304403.6/1100000: 28% mana | 1.0/5: 20% soul_shard tormented_souls(5), active_uas(2), accelerando
2:42.610 default D soul_harvest Fluffy_Pillow 320956.7/1100000: 29% mana | 1.0/5: 20% soul_shard tormented_souls(5), active_uas(3), accelerando
2:42.610 default E potion Fluffy_Pillow 320956.7/1100000: 29% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(5), active_uas(3), accelerando
2:42.610 default N reap_souls Fluffy_Pillow 320956.7/1100000: 29% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(5), active_uas(3), accelerando, potion_of_prolonged_power
2:42.610 default Q drain_soul Fluffy_Pillow 320956.7/1100000: 29% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
2:45.383 default J corruption Fluffy_Pillow 257910.9/1100000: 23% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls, active_uas(3), accelerando(2), potion_of_prolonged_power
2:46.648 default Q drain_soul Fluffy_Pillow 241522.5/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, active_uas(3), accelerando(3), potion_of_prolonged_power
2:48.495 default M unstable_affliction Fluffy_Pillow 200200.8/1100000: 18% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, active_uas, accelerando(4), potion_of_prolonged_power
2:49.718 default M unstable_affliction Fluffy_Pillow 216749.0/1100000: 20% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls, active_uas, accelerando(4), potion_of_prolonged_power
2:50.942 default Q drain_soul Fluffy_Pillow 233310.8/1100000: 21% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls, active_uas(2), accelerando(4), potion_of_prolonged_power
2:56.945 default G agony Fluffy_Pillow 80327.9/1100000: 7% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), compounding_horror(3), potion_of_prolonged_power
2:58.254 default H life_tap Fluffy_Pillow 63889.1/1100000: 6% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), compounding_horror(3), potion_of_prolonged_power
2:59.563 default I corruption Fluffy_Pillow 410508.7/1100000: 37% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), compounding_horror(4), accelerando, potion_of_prolonged_power
3:00.847 default Q drain_soul Fluffy_Pillow 394036.1/1100000: 36% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(4), accelerando, potion_of_prolonged_power
3:05.408 default M unstable_affliction Fluffy_Pillow 287808.1/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(5), nefarious_pact, accelerando(2), potion_of_prolonged_power
3:06.272 default Q drain_soul Fluffy_Pillow 299119.1/1100000: 27% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(5), active_uas, nefarious_pact, accelerando(2), potion_of_prolonged_power
3:10.521 default Q drain_soul Fluffy_Pillow 124427.2/1100000: 11% mana | 0.0/5: 0% soul_shard tormented_souls(5), compounding_horror, active_uas, nefarious_pact, accelerando(3), potion_of_prolonged_power
3:11.904 default H life_tap Fluffy_Pillow 76436.3/1100000: 7% mana | 0.0/5: 0% soul_shard tormented_souls(6), compounding_horror, nefarious_pact, potion_of_prolonged_power
3:12.797 default G agony Fluffy_Pillow 417827.6/1100000: 38% mana | 1.0/5: 20% soul_shard tormented_souls(6), compounding_horror, nefarious_pact, accelerando, potion_of_prolonged_power
3:13.676 default I corruption Fluffy_Pillow 396141.9/1100000: 36% mana | 1.0/5: 20% soul_shard tormented_souls(6), compounding_horror, nefarious_pact, accelerando, potion_of_prolonged_power
3:14.554 default M unstable_affliction Fluffy_Pillow 374443.3/1100000: 34% mana | 1.0/5: 20% soul_shard tormented_souls(6), compounding_horror, nefarious_pact, accelerando, potion_of_prolonged_power
3:15.432 default O reap_souls Fluffy_Pillow 385745.3/1100000: 35% mana | 0.0/5: 0% soul_shard tormented_souls(6), active_uas, devils_due, accelerando(2), potion_of_prolonged_power
3:15.432 default Q drain_soul Fluffy_Pillow 385745.3/1100000: 35% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, devils_due, accelerando(2), potion_of_prolonged_power
3:22.598 default M unstable_affliction Fluffy_Pillow 252330.0/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas, devils_due, accelerando(5), potion_of_prolonged_power
3:24.026 default Q drain_soul Fluffy_Pillow 271965.9/1100000: 25% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(5), potion_of_prolonged_power
3:27.491 default J corruption Fluffy_Pillow 184460.7/1100000: 17% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando, potion_of_prolonged_power
3:28.776 default Q drain_soul Fluffy_Pillow 168001.0/1100000: 15% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando, potion_of_prolonged_power
3:31.603 default G agony Fluffy_Pillow 105881.1/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, accelerando(3), potion_of_prolonged_power
3:32.848 default H life_tap Fluffy_Pillow 89453.5/1100000: 8% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror, accelerando(3), potion_of_prolonged_power
3:34.091 default M unstable_affliction Fluffy_Pillow 435999.3/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror, accelerando(3), potion_of_prolonged_power
3:35.335 default Q drain_soul Fluffy_Pillow 452558.4/1100000: 41% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), active_uas, accelerando(3), potion_of_prolonged_power
3:41.443 default J corruption Fluffy_Pillow 301004.4/1100000: 27% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), active_uas, accelerando, potion_of_prolonged_power
3:42.729 default Q drain_soul Fluffy_Pillow 284695.0/1100000: 26% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), accelerando(2)
3:48.913 default G agony Fluffy_Pillow 134652.7/1100000: 12% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror, accelerando(2)
3:50.178 default M unstable_affliction Fluffy_Pillow 118213.4/1100000: 11% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror, accelerando(2)
3:51.442 default O reap_souls Fluffy_Pillow 134761.0/1100000: 12% mana | 0.0/5: 0% soul_shard tormented_souls(4), active_uas, accelerando(2)
3:51.442 default Q drain_soul Fluffy_Pillow 134761.0/1100000: 12% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando(2)
3:53.337 default H life_tap Fluffy_Pillow 93126.7/1100000: 8% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas
3:54.646 default Q drain_soul Fluffy_Pillow 439687.9/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas
3:56.613 default J corruption Fluffy_Pillow 398573.9/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas
3:57.921 default M unstable_affliction Fluffy_Pillow 382406.4/1100000: 35% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, accelerando
3:59.205 default Q drain_soul Fluffy_Pillow 398933.8/1100000: 36% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas, accelerando
4:07.124 default G agony Fluffy_Pillow 204131.3/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(3), accelerando(2)
4:08.387 default Q drain_soul Fluffy_Pillow 187665.8/1100000: 17% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(3), accelerando(2)
4:10.286 default I corruption Fluffy_Pillow 145798.4/1100000: 13% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(3), nefarious_pact
4:11.181 default M unstable_affliction Fluffy_Pillow 124121.7/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(4), nefarious_pact
4:12.076 default O reap_souls Fluffy_Pillow 135445.0/1100000: 12% mana | 0.0/5: 0% soul_shard tormented_souls(5), active_uas, nefarious_pact
4:12.076 default Q drain_soul Fluffy_Pillow 135445.0/1100000: 12% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, nefarious_pact
4:13.522 default H life_tap Fluffy_Pillow 87739.4/1100000: 8% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas, nefarious_pact
4:14.416 default Q drain_soul Fluffy_Pillow 429050.1/1100000: 39% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas, nefarious_pact
4:18.818 default M unstable_affliction Fluffy_Pillow 254711.6/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(4), nefarious_pact, accelerando
4:19.698 default Q drain_soul Fluffy_Pillow 266038.8/1100000: 24% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, nefarious_pact, accelerando
4:24.406 default F corruption Fluffy_Pillow 95639.0/1100000: 9% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror, devils_due, accelerando
4:25.932 default G agony Fluffy_Pillow 82281.3/1100000: 7% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror, devils_due, accelerando
4:27.456 default H life_tap Fluffy_Pillow 68807.7/1100000: 6% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror, devils_due, accelerando
4:28.980 default Q drain_soul Fluffy_Pillow 418424.2/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(6), compounding_horror, devils_due, accelerando
4:31.173 default K unstable_affliction Fluffy_Pillow 380652.0/1100000: 35% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(6), accelerando
4:32.459 default Q drain_soul Fluffy_Pillow 397205.1/1100000: 36% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(6), active_uas, accelerando
4:38.596 default B reap_souls Fluffy_Pillow 245422.1/1100000: 22% mana | 0.0/5: 0% soul_shard tormented_souls(7), compounding_horror(2), active_uas, accelerando(2)
4:38.596 default F corruption Fluffy_Pillow 245422.1/1100000: 22% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), active_uas, accelerando(2)
4:39.861 default K unstable_affliction Fluffy_Pillow 228527.7/1100000: 21% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2)
4:41.170 default Q drain_soul Fluffy_Pillow 245088.8/1100000: 22% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas
4:45.665 default C agony Fluffy_Pillow 137519.3/1100000: 13% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), active_uas, accelerando(2)
4:46.928 default K unstable_affliction Fluffy_Pillow 121053.8/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(4), active_uas, accelerando(2)
4:48.194 default Q drain_soul Fluffy_Pillow 137627.6/1100000: 13% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando(2)
4:50.140 default P life_tap Fluffy_Pillow 97196.8/1100000: 9% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando(3)
4:51.383 default J corruption Fluffy_Pillow 443742.6/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando(3)
4:52.628 default Q drain_soul Fluffy_Pillow 427315.0/1100000: 39% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(3)
4:55.295 default K unstable_affliction Fluffy_Pillow 363815.9/1100000: 33% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, accelerando(3)
4:56.539 default Q drain_soul Fluffy_Pillow 379873.6/1100000: 35% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 56502 56502 35517
Intellect 51202 49496 39812 (1278)
Spirit 0 0 0
Health 3390120 3390120 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 51202 49496 0
Crit 23.19% 23.19% 7275
Haste 15.02% 15.02% 5631
Damage / Heal Versatility 1.27% 1.27% 601
ManaReg per Second 12652 12652 0
Mastery 118.87% 115.91% 11634
Armor 2015 2015 2015
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 910.00
Local Head Eyes of Azj'Aqir
ilevel: 905, stats: { 257 Armor, +3410 Sta, +2273 Int, +1094 Haste, +589 Vers }
Local Neck Beleron's Choker of Misery
ilevel: 905, stats: { +1918 Sta, +1727 Crit, +1295 Mastery }, enchant: { +600 Mastery }
Local Shoulders Celumbra, the Night's Dichotomy
ilevel: 940, stats: { 269 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Crit }, gems: { +150 Mastery, +150 Mastery, +150 Mastery }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Master Warmage's Leggings
ilevel: 905, stats: { 277 Armor, +3410 Sta, +2273 Int, +914 Mastery, +769 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Bracers of Harnessed Flame
ilevel: 905, stats: { 139 Armor, +1918 Sta, +1278 Int, +595 Mastery, +351 Crit }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Spellblade's Gemmed Signet
ilevel: 905, stats: { +1918 Sta, +2073 Crit, +950 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Temporal Recalibration
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +636 Mastery, +311 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Celumbra_the_Nights_Dichotomy"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3518
neck=belerons_choker_of_misery,id=140899,bonus_id=3518,enchant=mark_of_the_trained_soldier
shoulders=celumbra_the_nights_dichotomy,id=146666,ilevel=940,gems=150mastery_150mastery_150mastery
back=cloak_of_temporal_recalibration,id=140910,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3518
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518
legs=master_warmages_leggings,id=140852,bonus_id=3518
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=spellblades_gemmed_signet,id=140895,bonus_id=3518,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=erratic_metronome,id=140792,bonus_id=3445
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=909.60
# gear_stamina=35517
# gear_intellect=39812
# gear_crit_rating=7132
# gear_haste_rating=5521
# gear_mastery_rating=11406
# gear_versatility_rating=589
# gear_armor=2015
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Hood_of_Eternal_Disdain : 960933 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
960932.9 960932.9 1453.2 / 0.151% 205112.6 / 21.3% 32.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
26896.5 26896.5 Mana 0.00% 32.8 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Hood_of_Eternal_Disdain 960933
Agony 147126 15.3% 18.9 16.49sec 2329205 1840788 Periodic 202.5 144878 382899 217745 30.6% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.93 0.00 202.55 202.55 1.2654 1.4773 44101598.56 44101598.56 0.00 136462.25 1840787.99
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 140.5 69.39% 144877.80 13784 244251 144924.68 125778 161825 20361497 20361497 0.00
crit 62.0 30.61% 382899.45 31980 644822 382903.59 303174 452973 23740102 23740102 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:16.38
  • base_tick_time:1.82
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 6520 0.7% 26.0 11.36sec 75009 0 Direct 26.0 60502 121826 75013 23.7%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.04 26.04 0.00 0.00 0.0000 0.0000 1953307.30 1953307.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.88 76.34% 60501.67 19789 190510 60703.35 34762 101028 1202643 1202643 0.00
crit 6.16 23.66% 121826.00 39577 381020 122074.84 0 322898 750664 750664 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 116758 12.2% 21.9 13.85sec 1595434 1286116 Periodic 183.8 126773 334936 190419 30.6% 99.2%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.93 0.00 183.76 183.76 1.2405 1.6203 34991348.77 34991348.77 0.00 107681.92 1286115.66
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.6 69.43% 126772.92 191 209700 126838.43 112439 140008 16173379 16173379 0.00
crit 56.2 30.57% 334935.98 1160 553607 335007.36 272743 387401 18817970 18817970 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 110359 11.5% 60.0 4.95sec 551299 188931 Periodic 203.7 123376 249048 162403 31.1% 54.5%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.99 0.00 203.66 203.66 2.9180 0.8023 33073530.98 33073530.98 0.00 188931.15 188931.15
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 140.4 68.95% 123375.67 78661 160031 123453.24 112090 131963 17323810 17323810 0.00
crit 63.2 31.05% 249048.28 157321 320062 249147.63 223115 270976 15749721 15749721 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 23542 2.5% 47.9 6.11sec 147360 0 Direct 47.7 119728 239221 148056 23.7%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.88 47.66 0.00 0.00 0.0000 0.0000 7055749.42 7055749.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.36 76.29% 119727.72 80392 154792 119705.01 103303 130896 4352962 4352962 0.00
crit 11.30 23.71% 239220.67 160784 309583 239202.85 188136 296684 2702788 2702788 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Soul 17468 1.8% 14.9 18.56sec 351975 0 Direct 14.9 284364 567824 351983 23.9%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.87 14.87 0.00 0.00 0.0000 0.0000 5234068.65 5234068.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.32 76.15% 284363.88 185517 357206 284189.61 194986 339043 3219955 3219955 0.00
crit 3.55 23.85% 567823.74 371034 714412 548352.43 0 714412 2014114 2014114 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (461760) 0.0% (48.0%) 49.9 5.98sec 2770084 2268291

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.93 0.00 0.00 0.00 1.2212 0.0000 0.00 0.00 0.00 2268291.22 2268291.22
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 191257 19.9% 0.0 0.00sec 0 0 Periodic 108.1 311967 833854 530384 41.9% 52.1%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 108.08 108.08 0.0000 1.4449 57325238.51 57325238.51 0.00 367074.17 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.8 58.15% 311967.10 371 495039 312497.61 256408 368224 19606736 19606736 0.00
crit 45.2 41.85% 833853.74 909 1306902 835099.26 636505 1028681 37718502 37718502 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 160644 16.7% 0.0 0.00sec 0 0 Periodic 84.1 334457 892959 572072 42.5% 40.1%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 84.14 84.14 0.0000 1.4296 48132132.92 48132132.92 0.00 400164.06 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.3 57.45% 334456.98 447 495039 335413.60 266314 415255 16167428 16167428 0.00
crit 35.8 42.55% 892959.48 335 1306902 895064.24 674917 1085224 31964705 31964705 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 99650 10.4% 0.0 0.00sec 0 0 Periodic 51.1 342266 910430 583470 42.5% 23.9%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 51.10 51.10 0.0000 1.4012 29812645.92 29812645.92 0.00 416395.18 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.4 57.55% 342265.60 447 495039 345044.62 252654 475712 10064544 10064544 0.00
crit 21.7 42.45% 910429.78 1111 1306902 917269.70 559846 1239227 19748102 19748102 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 8508 0.9% 0.0 0.00sec 0 0 Periodic 4.8 310638 829250 527222 41.8% 2.3%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 4.81 4.81 0.0000 1.4482 2536617.61 2536617.61 0.00 364038.12 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.8 58.25% 310638.44 1078 495039 191976.69 0 495039 870467 870467 0.00
crit 2.0 41.75% 829249.92 4290 1306902 490255.94 0 1306902 1666150 1666150 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 1701 0.2% 0.0 0.00sec 0 0 Periodic 1.0 298241 792058 504637 41.8% 0.5%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 1.00 1.00 0.0000 1.4640 506958.74 506958.74 0.00 344869.89 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.6 58.20% 298240.54 2156 495039 54142.94 0 495039 174386 174386 0.00
crit 0.4 41.80% 792057.96 7178 1306902 133308.57 0 1306902 332572 332572 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 77400 / 77400
Doom Bolt 77400 8.1% 118.5 2.52sec 195860 79637 Direct 117.7 159244 318596 197140 23.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.48 117.71 0.00 0.00 2.4594 0.0000 23205808.83 23205808.83 0.00 79636.68 79636.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.72 76.22% 159243.98 132084 228467 159285.82 150843 167504 14287800 14287800 0.00
crit 27.99 23.78% 318595.97 264169 456934 318672.63 289894 347844 8918009 8918009 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Hood_of_Eternal_Disdain
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hood_of_Eternal_Disdain
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hood_of_Eternal_Disdain
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hood_of_Eternal_Disdain
  • harmful:false
  • if_expr:
 
Life Tap 10.2 25.08sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.24 0.00 0.00 0.00 1.2601 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 13.2 23.40sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.23 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.4 149.99sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.41 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.9 0.0 15.4sec 15.4sec 78.09% 78.09% 2.1(2.1) 19.1

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.07%
  • accelerando_2:23.77%
  • accelerando_3:14.40%
  • accelerando_4:6.96%
  • accelerando_5:3.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 22.0 27.8 13.8sec 0.0sec 58.09% 58.09% 0.0(0.0) 0.0

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:27.81%
  • active_uas_2:18.79%
  • active_uas_3:11.07%
  • active_uas_4:0.34%
  • active_uas_5:0.09%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 28.0 39.2 10.7sec 4.4sec 60.79% 100.00% 2.3(2.3) 1.4

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:25.38%
  • compounding_horror_2:16.56%
  • compounding_horror_3:9.86%
  • compounding_horror_4:5.12%
  • compounding_horror_5:3.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 13.2 0.0 23.2sec 23.2sec 73.18% 73.18% 0.0(0.0) 12.3

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:73.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.8sec 68.8sec 8.75% 8.75% 0.0(0.0) 3.2

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.75%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.5 0.0 69.1sec 68.3sec 13.58% 13.58% 0.0(0.0) 3.3

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.58%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 160.1sec 0.0sec 39.29% 39.29% 0.0(0.0) 1.9

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.4 0.0 150.1sec 150.1sec 13.51% 13.51% 0.0(0.0) 2.4

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 13.9 32.8 22.4sec 6.8sec 74.27% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:23.94%
  • tormented_souls_2:18.64%
  • tormented_souls_3:13.07%
  • tormented_souls_4:8.82%
  • tormented_souls_5:4.88%
  • tormented_souls_6:2.66%
  • tormented_souls_7:1.50%
  • tormented_souls_8:0.47%
  • tormented_souls_9:0.17%
  • tormented_souls_10:0.07%
  • tormented_souls_11:0.03%
  • tormented_souls_12:0.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 6.2 40.4sec
t18_2pc_affliction 49.9 6.0sec
soul_conduit 10.0 27.1sec
souls_consumed 45.2 23.2sec

Resources

Resource Usage Type Count Total Average RPE APR
Hood_of_Eternal_Disdain
agony Mana 18.9 624829.9 33000.0 33000.1 70.6
corruption Mana 21.9 723763.9 33000.0 33000.1 48.3
drain_soul Mana 203.7 6720628.4 33000.0 112025.4 4.9
unstable_affliction Soul Shard 49.9 49.9 1.0 1.0 2770125.6
pet - doomguard
doom_bolt Energy 118.5 4146.9 35.0 35.0 5596.0
Resource Gains Type Count Total Average Overflow
life_tap Mana 10.24 3378360.98 (46.66%) 330000.00 0.00 0.00%
agony Soul Shard 37.29 37.29 (78.00%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.57 0.57 (1.19%) 1.00 0.00 0.00%
mp5_regen Mana 348.10 3861931.62 (53.34%) 11094.20 21675.26 0.56%
soul_conduit Soul Shard 9.95 9.95 (20.81%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 191.87 4105.35 (100.00%) 21.40 113.74 2.70%
Resource RPS-Gain RPS-Loss
Health 0.00 11868.86
Mana 24133.45 26896.50
Soul Shard 0.16 0.17
Combat End Resource Mean Min Max
Mana 273328.26 39372.53 503125.31
Soul Shard 0.87 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Hood_of_Eternal_Disdain Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Hood_of_Eternal_Disdain Damage Per Second
Count 4999
Mean 960932.89
Minimum 784317.78
Maximum 1161260.03
Spread ( max - min ) 376942.25
Range [ ( max - min ) / 2 * 100% ] 19.61%
Standard Deviation 52424.2798
5th Percentile 878469.14
95th Percentile 1051428.00
( 95th Percentile - 5th Percentile ) 172958.86
Mean Distribution
Standard Deviation 741.4654
95.00% Confidence Intervall ( 959479.65 - 962386.14 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11434
0.1 Scale Factor Error with Delta=300 23461114
0.05 Scale Factor Error with Delta=300 93844453
0.01 Scale Factor Error with Delta=300 2346111321
Priority Target DPS
Sample Data Hood_of_Eternal_Disdain Priority Target Damage Per Second
Count 4999
Mean 960932.89
Minimum 784317.78
Maximum 1161260.03
Spread ( max - min ) 376942.25
Range [ ( max - min ) / 2 * 100% ] 19.61%
Standard Deviation 52424.2798
5th Percentile 878469.14
95th Percentile 1051428.00
( 95th Percentile - 5th Percentile ) 172958.86
Mean Distribution
Standard Deviation 741.4654
95.00% Confidence Intervall ( 959479.65 - 962386.14 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11434
0.1 Scale Factor Error with Delta=300 23461114
0.05 Scale Factor Error with Delta=300 93844453
0.01 Scale Factor Error with Delta=300 2346111321
DPS(e)
Sample Data Hood_of_Eternal_Disdain Damage Per Second (Effective)
Count 4999
Mean 960932.89
Minimum 784317.78
Maximum 1161260.03
Spread ( max - min ) 376942.25
Range [ ( max - min ) / 2 * 100% ] 19.61%
Damage
Sample Data Hood_of_Eternal_Disdain Damage
Count 4999
Mean 264723197.39
Minimum 174701299.48
Maximum 367365902.19
Spread ( max - min ) 192664602.71
Range [ ( max - min ) / 2 * 100% ] 36.39%
DTPS
Sample Data Hood_of_Eternal_Disdain Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Hood_of_Eternal_Disdain Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Hood_of_Eternal_Disdain Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Hood_of_Eternal_Disdain Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Hood_of_Eternal_Disdain Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Hood_of_Eternal_Disdain Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Hood_of_Eternal_DisdainTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Hood_of_Eternal_Disdain Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 1.34 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 5.75 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
D 2.41 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
E 0.99 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 0.64 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
G 13.18 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
H 9.69 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
I 13.30 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
J 7.99 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
K 6.91 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
L 3.63 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
M 39.59 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
N 9.97 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
O 1.91 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
P 0.55 life_tap,if=mana.pct<=10
Q 45.99 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACIMMMDNQGIMMMQIQGMMMNQIQGMMMKNQJQQGHLQJQMOQCLJMNQLQNQHLQCJMMMNQIGMMQNQHIQGMMMDENQQHIQGMMMNQJQQHQCQIMMQHQGQIMMNQGHIMQMQJQCMOQQHIQGMQIQHQGMMQBJQGMQJHMQKQCFQKKKDQCFKKKK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Hood_of_Eternal_Disdain 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Hood_of_Eternal_Disdain 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Hood_of_Eternal_Disdain 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.371 default I corruption Fluffy_Pillow 1088919.2/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:02.408 default M unstable_affliction Fluffy_Pillow 1072498.6/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:03.443 default M unstable_affliction Fluffy_Pillow 1089045.9/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, accelerando, potion_of_prolonged_power
0:04.479 default M unstable_affliction Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), accelerando(2), potion_of_prolonged_power
0:05.499 default D soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(3), accelerando(2), potion_of_prolonged_power
0:05.499 default N reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, active_uas(3), accelerando(2), potion_of_prolonged_power
0:05.499 default Q drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), accelerando(2), potion_of_prolonged_power
0:11.763 default G agony Fluffy_Pillow 905184.2/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, compounding_horror, accelerando(3), potion_of_prolonged_power
0:12.764 default I corruption Fluffy_Pillow 888105.1/1100000: 81% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, compounding_horror, potion_of_prolonged_power
0:13.819 default M unstable_affliction Fluffy_Pillow 871670.9/1100000: 79% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, compounding_horror, potion_of_prolonged_power
0:14.873 default M unstable_affliction Fluffy_Pillow 888221.0/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas, potion_of_prolonged_power
0:15.926 default M unstable_affliction Fluffy_Pillow 904755.4/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(2), potion_of_prolonged_power
0:16.982 default Q drain_soul Fluffy_Pillow 921336.9/1100000: 84% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(2), potion_of_prolonged_power
0:26.154 default I corruption Fluffy_Pillow 638777.7/1100000: 58% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, compounding_horror(4), accelerando(2), potion_of_prolonged_power
0:27.171 default Q drain_soul Fluffy_Pillow 622327.8/1100000: 57% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls, compounding_horror(4), accelerando(2), potion_of_prolonged_power
0:28.754 default G agony Fluffy_Pillow 582349.6/1100000: 53% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls, compounding_horror(4), accelerando(3), potion_of_prolonged_power
0:29.754 default M unstable_affliction Fluffy_Pillow 565908.6/1100000: 51% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, tormented_souls, compounding_horror(4), accelerando(3), potion_of_prolonged_power
0:30.755 default M unstable_affliction Fluffy_Pillow 581697.3/1100000: 53% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls, active_uas, accelerando, potion_of_prolonged_power
0:31.790 default M unstable_affliction Fluffy_Pillow 598244.7/1100000: 54% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(2), active_uas(2), accelerando, potion_of_prolonged_power
0:32.825 default N reap_souls Fluffy_Pillow 614792.0/1100000: 56% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(2), active_uas(3), accelerando, potion_of_prolonged_power
0:32.825 default Q drain_soul Fluffy_Pillow 614792.0/1100000: 56% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
0:39.904 default I corruption Fluffy_Pillow 398027.2/1100000: 36% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls(2), compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:40.921 default Q drain_soul Fluffy_Pillow 381577.3/1100000: 35% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls(2), compounding_horror(3), accelerando(2), potion_of_prolonged_power
0:44.499 default G agony Fluffy_Pillow 260598.2/1100000: 24% mana | 3.0/5: 60% soul_shard tormented_souls(3), compounding_horror(3), potion_of_prolonged_power
0:45.869 default M unstable_affliction Fluffy_Pillow 244145.8/1100000: 22% mana | 3.0/5: 60% soul_shard tormented_souls(3), compounding_horror(3), potion_of_prolonged_power
0:47.239 default M unstable_affliction Fluffy_Pillow 260694.4/1100000: 24% mana | 3.0/5: 60% soul_shard tormented_souls(3), active_uas, accelerando, potion_of_prolonged_power
0:48.585 default M unstable_affliction Fluffy_Pillow 277247.9/1100000: 25% mana | 3.0/5: 60% soul_shard tormented_souls(4), active_uas(2), accelerando, potion_of_prolonged_power
0:49.932 default K unstable_affliction Fluffy_Pillow 293813.7/1100000: 27% mana | 4.0/5: 80% soul_shard tormented_souls(4), active_uas(3), accelerando, potion_of_prolonged_power
0:51.278 default N reap_souls Fluffy_Pillow 310568.2/1100000: 28% mana | 3.0/5: 60% soul_shard tormented_souls(4), active_uas(4), accelerando(3), potion_of_prolonged_power
0:51.278 default Q drain_soul Fluffy_Pillow 310568.2/1100000: 28% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(4), accelerando(3), potion_of_prolonged_power
0:54.117 default J corruption Fluffy_Pillow 247730.6/1100000: 23% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, active_uas(4), accelerando(3), potion_of_prolonged_power
0:55.418 default Q drain_soul Fluffy_Pillow 231549.4/1100000: 21% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas(3), accelerando(4), potion_of_prolonged_power
0:59.090 default Q drain_soul Fluffy_Pillow 147130.1/1100000: 13% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(4)
1:00.970 default G agony Fluffy_Pillow 104075.1/1100000: 9% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando
1:02.314 default H life_tap Fluffy_Pillow 87604.0/1100000: 8% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror(4), accelerando
1:03.660 default L unstable_affliction Fluffy_Pillow 434157.5/1100000: 39% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(4), accelerando
1:05.004 default Q drain_soul Fluffy_Pillow 450686.5/1100000: 41% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando
1:07.848 default J corruption Fluffy_Pillow 386712.5/1100000: 35% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(2)
1:09.170 default Q drain_soul Fluffy_Pillow 370261.3/1100000: 34% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(2)
1:11.237 default M unstable_affliction Fluffy_Pillow 330397.2/1100000: 30% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(3)
1:12.537 default O reap_souls Fluffy_Pillow 346912.0/1100000: 32% mana | 3.0/5: 60% soul_shard tormented_souls(2), active_uas
1:12.537 default Q drain_soul Fluffy_Pillow 346912.0/1100000: 32% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas
1:19.038 default C agony Fluffy_Pillow 194434.9/1100000: 18% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas
1:20.410 default L unstable_affliction Fluffy_Pillow 178057.7/1100000: 16% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando
1:21.755 default J corruption Fluffy_Pillow 194598.9/1100000: 18% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando
1:23.102 default M unstable_affliction Fluffy_Pillow 178164.7/1100000: 16% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas, accelerando
1:24.448 default N reap_souls Fluffy_Pillow 194718.2/1100000: 18% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas(2), accelerando
1:24.448 default Q drain_soul Fluffy_Pillow 194718.2/1100000: 18% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(2), accelerando
1:26.467 default L unstable_affliction Fluffy_Pillow 153548.5/1100000: 14% mana | 4.0/5: 80% soul_shard deadwind_harvester, active_uas(2), accelerando
1:27.811 default Q drain_soul Fluffy_Pillow 170078.1/1100000: 15% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(3), accelerando(2)
1:29.947 default N reap_souls Fluffy_Pillow 131092.9/1100000: 12% mana | 3.0/5: 60% soul_shard tormented_souls(2), active_uas(2), accelerando(3)
1:29.947 default Q drain_soul Fluffy_Pillow 131092.9/1100000: 12% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(2), accelerando(3)
1:31.977 default H life_tap Fluffy_Pillow 90950.4/1100000: 8% mana | 4.0/5: 80% soul_shard deadwind_harvester, active_uas, accelerando(3)
1:33.276 default L unstable_affliction Fluffy_Pillow 436927.7/1100000: 40% mana | 4.0/5: 80% soul_shard deadwind_harvester, compounding_horror, active_uas, accelerando
1:34.621 default Q drain_soul Fluffy_Pillow 453468.9/1100000: 41% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(2), accelerando
1:36.652 default C agony Fluffy_Pillow 412518.1/1100000: 38% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(2)
1:37.974 default J corruption Fluffy_Pillow 396066.9/1100000: 36% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, accelerando(2)
1:39.296 default M unstable_affliction Fluffy_Pillow 379615.7/1100000: 35% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, accelerando(2)
1:40.621 default M unstable_affliction Fluffy_Pillow 396476.7/1100000: 36% mana | 2.0/5: 40% soul_shard tormented_souls(3), active_uas(2), accelerando(3)
1:41.919 default M unstable_affliction Fluffy_Pillow 413010.2/1100000: 38% mana | 1.0/5: 20% soul_shard tormented_souls(3), active_uas(2), accelerando(3)
1:43.219 default N reap_souls Fluffy_Pillow 429569.3/1100000: 39% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas(2), accelerando(3)
1:43.219 default Q drain_soul Fluffy_Pillow 429569.3/1100000: 39% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(3)
1:49.576 default I corruption Fluffy_Pillow 276244.6/1100000: 25% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror
1:50.947 default G agony Fluffy_Pillow 259804.4/1100000: 24% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2)
1:52.316 default M unstable_affliction Fluffy_Pillow 243438.8/1100000: 22% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando
1:53.660 default M unstable_affliction Fluffy_Pillow 259967.7/1100000: 24% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando
1:55.005 default Q drain_soul Fluffy_Pillow 276508.9/1100000: 25% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas(2), accelerando
1:58.790 default N reap_souls Fluffy_Pillow 191058.0/1100000: 17% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(2), accelerando
1:58.790 default Q drain_soul Fluffy_Pillow 191058.0/1100000: 17% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando
2:02.688 default H life_tap Fluffy_Pillow 108740.5/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, nefarious_pact, accelerando(4)
2:03.562 default I corruption Fluffy_Pillow 450065.5/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, nefarious_pact, accelerando(4)
2:04.437 default Q drain_soul Fluffy_Pillow 427901.5/1100000: 39% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, nefarious_pact
2:06.508 default G agony Fluffy_Pillow 353916.3/1100000: 32% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror, nefarious_pact
2:07.444 default M unstable_affliction Fluffy_Pillow 332221.8/1100000: 30% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror, nefarious_pact
2:08.379 default M unstable_affliction Fluffy_Pillow 343515.3/1100000: 31% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas, nefarious_pact
2:09.316 default M unstable_affliction Fluffy_Pillow 354832.9/1100000: 32% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas(2), nefarious_pact
2:10.251 default D soul_harvest Fluffy_Pillow 366265.3/1100000: 33% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas(3), nefarious_pact, accelerando
2:10.251 default E potion Fluffy_Pillow 366265.3/1100000: 33% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls(2), active_uas(3), nefarious_pact, accelerando
2:10.251 default N reap_souls Fluffy_Pillow 366265.3/1100000: 33% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls(2), active_uas(3), nefarious_pact, accelerando, potion_of_prolonged_power
2:10.251 default Q drain_soul Fluffy_Pillow 366265.3/1100000: 33% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(3), nefarious_pact, accelerando, potion_of_prolonged_power
2:16.474 default Q drain_soul Fluffy_Pillow 112797.5/1100000: 10% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(4), compounding_horror, devils_due, accelerando, potion_of_prolonged_power
2:18.752 default H life_tap Fluffy_Pillow 75192.5/1100000: 7% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls(5), compounding_horror, devils_due, accelerando(3), potion_of_prolonged_power
2:20.295 default I corruption Fluffy_Pillow 424846.8/1100000: 39% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls(5), compounding_horror, devils_due, accelerando(3), potion_of_prolonged_power
2:21.837 default Q drain_soul Fluffy_Pillow 411344.6/1100000: 37% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls(5), compounding_horror, potion_of_prolonged_power
2:23.846 default G agony Fluffy_Pillow 369610.5/1100000: 34% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls(5), compounding_horror, nefarious_pact, potion_of_prolonged_power
2:24.781 default M unstable_affliction Fluffy_Pillow 347904.0/1100000: 32% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls(5), nefarious_pact, potion_of_prolonged_power
2:25.717 default M unstable_affliction Fluffy_Pillow 359209.5/1100000: 33% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(5), active_uas, nefarious_pact, potion_of_prolonged_power
2:26.653 default M unstable_affliction Fluffy_Pillow 370679.2/1100000: 34% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(5), active_uas(2), nefarious_pact, accelerando, potion_of_prolonged_power
2:27.573 default N reap_souls Fluffy_Pillow 381993.6/1100000: 35% mana | 0.0/5: 0% soul_shard tormented_souls(5), active_uas(3), nefarious_pact, accelerando, potion_of_prolonged_power
2:27.573 default Q drain_soul Fluffy_Pillow 381993.6/1100000: 35% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), nefarious_pact, accelerando, potion_of_prolonged_power
2:32.107 default J corruption Fluffy_Pillow 207214.6/1100000: 19% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas, nefarious_pact, accelerando(2), potion_of_prolonged_power
2:33.012 default Q drain_soul Fluffy_Pillow 185670.8/1100000: 17% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror, nefarious_pact, accelerando(3), potion_of_prolonged_power
2:35.118 default Q drain_soul Fluffy_Pillow 113830.2/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(4), devils_due, accelerando(4), potion_of_prolonged_power
2:37.355 default H life_tap Fluffy_Pillow 76816.6/1100000: 7% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(4), devils_due, accelerando(4), potion_of_prolonged_power
2:38.871 default Q drain_soul Fluffy_Pillow 425612.1/1100000: 39% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(4), devils_due, potion_of_prolonged_power
2:41.219 default C agony Fluffy_Pillow 387972.6/1100000: 35% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(4), devils_due, potion_of_prolonged_power
2:42.845 default Q drain_soul Fluffy_Pillow 374634.8/1100000: 34% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(4), nefarious_pact, accelerando, potion_of_prolonged_power
2:45.494 default I corruption Fluffy_Pillow 275417.3/1100000: 25% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, nefarious_pact, accelerando(2), potion_of_prolonged_power
2:46.399 default M unstable_affliction Fluffy_Pillow 253746.1/1100000: 23% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, nefarious_pact, accelerando(2), potion_of_prolonged_power
2:47.302 default M unstable_affliction Fluffy_Pillow 265125.4/1100000: 24% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas, nefarious_pact, accelerando(3), potion_of_prolonged_power
2:48.189 default Q drain_soul Fluffy_Pillow 276423.8/1100000: 25% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), nefarious_pact, accelerando(3), potion_of_prolonged_power
2:52.511 default H life_tap Fluffy_Pillow 101363.4/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, active_uas, nefarious_pact, accelerando(4), potion_of_prolonged_power
2:53.385 default Q drain_soul Fluffy_Pillow 442688.5/1100000: 40% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror, nefarious_pact, accelerando(4), potion_of_prolonged_power
2:55.954 default G agony Fluffy_Pillow 342912.2/1100000: 31% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror, devils_due, potion_of_prolonged_power
2:57.579 default Q drain_soul Fluffy_Pillow 329539.9/1100000: 30% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror, devils_due, potion_of_prolonged_power
2:59.979 default I corruption Fluffy_Pillow 292818.5/1100000: 27% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror, devils_due, accelerando, potion_of_prolonged_power
3:01.574 default M unstable_affliction Fluffy_Pillow 279490.5/1100000: 25% mana | 2.0/5: 40% soul_shard tormented_souls(4), devils_due, accelerando(2), potion_of_prolonged_power
3:03.142 default M unstable_affliction Fluffy_Pillow 299118.8/1100000: 27% mana | 1.0/5: 20% soul_shard tormented_souls(4), active_uas, accelerando(2), potion_of_prolonged_power
3:04.464 default N reap_souls Fluffy_Pillow 315667.6/1100000: 29% mana | 0.0/5: 0% soul_shard tormented_souls(5), active_uas(2), accelerando(2), potion_of_prolonged_power
3:04.464 default Q drain_soul Fluffy_Pillow 315667.6/1100000: 29% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(2), potion_of_prolonged_power
3:12.693 default G agony Fluffy_Pillow 120856.3/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), accelerando
3:14.038 default H life_tap Fluffy_Pillow 104397.5/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(2), accelerando
3:15.382 default I corruption Fluffy_Pillow 450926.4/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(3), accelerando
3:16.729 default M unstable_affliction Fluffy_Pillow 434492.2/1100000: 39% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(6), compounding_horror(3), accelerando
3:18.076 default Q drain_soul Fluffy_Pillow 451058.0/1100000: 41% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(6), active_uas, accelerando
3:21.858 default M unstable_affliction Fluffy_Pillow 365616.7/1100000: 33% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(6), compounding_horror, active_uas, accelerando(2)
3:23.181 default Q drain_soul Fluffy_Pillow 382178.0/1100000: 35% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(6), active_uas(2), accelerando(2)
3:27.880 default J corruption Fluffy_Pillow 274716.8/1100000: 25% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(6), compounding_horror(3), active_uas, accelerando
3:29.224 default Q drain_soul Fluffy_Pillow 258245.7/1100000: 23% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(6), compounding_horror(3), active_uas, accelerando
3:31.230 default C agony Fluffy_Pillow 216916.1/1100000: 20% mana | 0.0/5: 0% soul_shard tormented_souls(7), compounding_horror(3), accelerando
3:32.579 default M unstable_affliction Fluffy_Pillow 200506.5/1100000: 18% mana | 1.0/5: 20% soul_shard tormented_souls(7), compounding_horror(3), accelerando
3:33.924 default O reap_souls Fluffy_Pillow 217047.7/1100000: 20% mana | 0.0/5: 0% soul_shard tormented_souls(7), active_uas, accelerando
3:33.924 default Q drain_soul Fluffy_Pillow 217047.7/1100000: 20% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando
3:38.733 default Q drain_soul Fluffy_Pillow 111950.3/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas
3:40.809 default H life_tap Fluffy_Pillow 71085.5/1100000: 6% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, accelerando
3:42.154 default I corruption Fluffy_Pillow 417626.7/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, accelerando
3:43.500 default Q drain_soul Fluffy_Pillow 401475.9/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, accelerando(2)
3:45.482 default G agony Fluffy_Pillow 360722.0/1100000: 33% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(3), accelerando(3)
3:46.781 default M unstable_affliction Fluffy_Pillow 344358.5/1100000: 31% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(3), accelerando(4)
3:48.057 default Q drain_soul Fluffy_Pillow 360893.2/1100000: 33% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(5)
3:55.792 default I corruption Fluffy_Pillow 162242.7/1100000: 15% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(2)
3:57.163 default Q drain_soul Fluffy_Pillow 145981.1/1100000: 13% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(3), accelerando
3:59.209 default H life_tap Fluffy_Pillow 105143.4/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(6), compounding_horror(4), accelerando
4:00.555 default Q drain_soul Fluffy_Pillow 451696.9/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(7), compounding_horror(5), accelerando
4:02.594 default G agony Fluffy_Pillow 410773.1/1100000: 37% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(8), compounding_horror(5), accelerando
4:03.940 default M unstable_affliction Fluffy_Pillow 394326.6/1100000: 36% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(8), compounding_horror(5), accelerando
4:05.284 default M unstable_affliction Fluffy_Pillow 411024.5/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(9), active_uas, accelerando(2)
4:06.606 default Q drain_soul Fluffy_Pillow 427676.1/1100000: 39% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(10), active_uas(2), accelerando(4)
4:09.286 default B reap_souls Fluffy_Pillow 362779.0/1100000: 33% mana | 0.0/5: 0% soul_shard tormented_souls(11), compounding_horror(2), active_uas(2)
4:09.286 default J corruption Fluffy_Pillow 362779.0/1100000: 33% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), active_uas(2)
4:10.656 default Q drain_soul Fluffy_Pillow 346326.6/1100000: 31% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas(2)
4:18.205 default G agony Fluffy_Pillow 174643.5/1100000: 16% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), accelerando(2)
4:19.528 default M unstable_affliction Fluffy_Pillow 158204.8/1100000: 14% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), accelerando(2)
4:20.850 default Q drain_soul Fluffy_Pillow 174753.6/1100000: 16% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(2)
4:23.672 default J corruption Fluffy_Pillow 111804.3/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(5)
4:24.929 default H life_tap Fluffy_Pillow 95368.4/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, accelerando(5)
4:26.186 default M unstable_affliction Fluffy_Pillow 441932.4/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), active_uas, accelerando(5)
4:27.442 default Q drain_soul Fluffy_Pillow 457152.5/1100000: 42% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2)
4:33.929 default K unstable_affliction Fluffy_Pillow 304589.8/1100000: 28% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(3), active_uas, accelerando
4:35.275 default Q drain_soul Fluffy_Pillow 321143.3/1100000: 29% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas, accelerando
4:37.258 default C agony Fluffy_Pillow 279530.8/1100000: 25% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas, accelerando
4:38.603 default F corruption Fluffy_Pillow 263072.0/1100000: 24% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, active_uas, accelerando
4:39.947 default Q drain_soul Fluffy_Pillow 246600.9/1100000: 22% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), active_uas, accelerando
4:42.122 default K unstable_affliction Fluffy_Pillow 207631.2/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), active_uas, accelerando(2)
4:43.445 default K unstable_affliction Fluffy_Pillow 224192.5/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas, accelerando(2)
4:44.768 default K unstable_affliction Fluffy_Pillow 240753.8/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), accelerando(2)
4:46.089 default D soul_harvest Fluffy_Pillow 257052.8/1100000: 23% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(3)
4:46.089 default Q drain_soul Fluffy_Pillow 257052.8/1100000: 23% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), active_uas(3)
4:52.699 default C agony Fluffy_Pillow 105945.0/1100000: 10% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(6), compounding_horror, active_uas, accelerando
4:54.044 default F corruption Fluffy_Pillow 89486.2/1100000: 8% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(7), compounding_horror(2), accelerando
4:55.389 default K unstable_affliction Fluffy_Pillow 73322.9/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(7), compounding_horror(4), accelerando(2)
4:56.712 default K unstable_affliction Fluffy_Pillow 89884.2/1100000: 8% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(7), active_uas, accelerando(2)
4:58.034 default K unstable_affliction Fluffy_Pillow 106433.0/1100000: 10% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(7), active_uas(2), accelerando(2)
4:59.356 default K unstable_affliction Fluffy_Pillow 122981.8/1100000: 11% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(7), active_uas(3), accelerando(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 56948 56948 35847
Intellect 51433 49727 40032 (1278)
Spirit 0 0 0
Health 3416880 3416880 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 51433 49727 0
Crit 23.71% 23.71% 7484
Haste 9.81% 9.81% 3677
Damage / Heal Versatility 1.07% 1.07% 506
ManaReg per Second 12079 12079 0
Mastery 130.16% 127.16% 13075
Armor 2018 2018 2018
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 910.00
Local Head Hood of Eternal Disdain
ilevel: 940, stats: { 292 Armor, +4726 Sta, +3150 Int, +822 Crit, +1097 Mastery }
Local Neck Beleron's Choker of Misery
ilevel: 905, stats: { +1918 Sta, +1727 Crit, +1295 Mastery }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Master Warmage's Leggings
ilevel: 905, stats: { 277 Armor, +3410 Sta, +2273 Int, +914 Mastery, +769 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Bracers of Harnessed Flame
ilevel: 905, stats: { 139 Armor, +1918 Sta, +1278 Int, +595 Mastery, +351 Crit }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Spellblade's Gemmed Signet
ilevel: 905, stats: { +1918 Sta, +2073 Crit, +950 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Temporal Recalibration
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +636 Mastery, +311 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Hood_of_Eternal_Disdain"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=hood_of_eternal_disdain,id=132394,ilevel=940
neck=belerons_choker_of_misery,id=140899,bonus_id=3518,enchant=mark_of_the_trained_soldier
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518
back=cloak_of_temporal_recalibration,id=140910,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3518
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518
legs=master_warmages_leggings,id=140852,bonus_id=3518
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=spellblades_gemmed_signet,id=140895,bonus_id=3518,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=erratic_metronome,id=140792,bonus_id=3445
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=909.60
# gear_stamina=35847
# gear_intellect=40032
# gear_crit_rating=7337
# gear_haste_rating=3605
# gear_mastery_rating=12819
# gear_versatility_rating=496
# gear_armor=2018
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Kiljadens_Burning_Wish : 927292 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
927292.2 927292.2 1434.7 / 0.155% 204673.2 / 22.1% 30.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
27605.3 27605.3 Mana 0.00% 33.3 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kiljadens_Burning_Wish 927292
Agony 132672 14.3% 17.3 18.13sec 2302026 1837607 Periodic 185.7 144071 380497 214178 29.7% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.28 0.00 185.71 185.71 1.2527 1.6108 39776839.52 39776839.52 0.00 123995.35 1837606.93
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.6 70.35% 144071.15 13660 242057 144100.61 126430 160362 18821408 18821408 0.00
crit 55.1 29.65% 380497.25 31692 639029 380536.52 294805 460204 20955431 20955431 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 6227 0.7% 24.8 11.96sec 75261 0 Direct 24.8 61251 122549 75260 22.9%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.79 24.79 0.00 0.00 0.0000 0.0000 1865963.16 1865963.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.13 77.14% 61250.60 20058 193098 61466.09 34860 95999 1171602 1171602 0.00
crit 5.67 22.86% 122549.15 40117 386197 122349.30 0 327285 694361 694361 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 116004 12.5% 21.9 13.85sec 1585080 1290150 Periodic 185.1 126092 333335 187836 29.8% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 0.00 185.14 185.14 1.2286 1.6087 34775995.18 34775995.18 0.00 107075.54 1290150.07
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.0 70.21% 126091.62 752 207816 126149.03 109939 139610 16389706 16389706 0.00
crit 55.2 29.79% 333334.72 5769 548634 333365.92 269441 395647 18386290 18386290 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 114245 12.3% 64.0 4.64sec 534986 187984 Periodic 211.7 123872 250173 161729 30.0% 56.5%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.01 0.00 211.75 211.75 2.8459 0.8004 34245822.55 34245822.55 0.00 187984.14 187984.14
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.3 70.03% 123871.53 79734 162205 123939.84 112753 134365 18367673 18367673 0.00
crit 63.5 29.97% 250172.94 159467 324410 250247.27 223956 273880 15878150 15878150 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 23784 2.6% 48.4 6.08sec 147312 0 Direct 48.2 120666 241296 148027 22.7%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.40 48.16 0.00 0.00 0.0000 0.0000 7129674.24 7129674.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.24 77.32% 120666.18 81489 156895 120667.57 105499 135939 4493543 4493543 0.00
crit 10.92 22.68% 241296.47 162977 313789 241313.49 167132 292128 2636131 2636131 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Kil'jaeden's Burning Wish 12427 1.3% 4.5 75.60sec 833150 0 Direct 4.4 0 838600 838600 100.0%  

Stats details: kiljaedens_burning_wish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.46 4.43 0.00 0.00 0.0000 0.0000 3718760.71 3718760.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.43 100.00% 838600.00 838600 838600 838600.00 838600 838600 3718761 3718761 0.00
 
 

Action details: kiljaedens_burning_wish

Static Values
  • id:235999
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:235999
  • name:Kil'jaeden's Burning Wish
  • school:fire
  • tooltip:
  • description:{$@spelldesc235991=Launch a vortex of destruction that seeks your current enemy. When it reaches the target, it explodes, dealing a critical strike to all enemies within $235999A1 yds for ${{$235999s1=112984 to 124877}*{$s2=200}/100} Fire damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:419300.00
  • base_dd_max:419300.00
 
Rend Soul 18042 1.9% 15.4 17.96sec 351163 0 Direct 15.4 286306 571760 351165 22.7%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.40 15.40 0.00 0.00 0.0000 0.0000 5406321.63 5406321.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.90 77.28% 286306.28 188048 362059 286069.21 217600 335167 3406312 3406312 0.00
crit 3.50 22.72% 571759.72 376096 724119 552738.74 0 724119 2000010 2000010 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (425593) 0.0% (45.9%) 46.1 6.48sec 2763161 2285643

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.13 0.00 0.00 0.00 1.2089 0.0000 0.00 0.00 0.00 2285642.70 2285642.70
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 189477 20.4% 0.0 0.00sec 0 0 Periodic 96.8 347882 928684 586977 41.2% 51.0%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 96.77 96.77 0.0000 1.5811 56803792.39 56803792.39 0.00 371237.50 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.9 58.83% 347882.26 2069 490592 348333.24 299895 392888 19806177 19806177 0.00
crit 39.8 41.17% 928684.24 4799 1295162 929728.67 780367 1100675 36997615 36997615 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 147612 15.9% 0.0 0.00sec 0 0 Periodic 70.9 368619 978973 623496 41.8% 36.9%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 70.92 70.92 0.0000 1.5622 44221081.06 44221081.06 0.00 399125.24 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.3 58.24% 368618.71 2069 490592 369525.18 309553 424263 15226561 15226561 0.00
crit 29.6 41.76% 978973.05 4799 1295162 981104.01 756336 1154784 28994520 28994520 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 82174 8.8% 0.0 0.00sec 0 0 Periodic 38.1 380285 1010062 644050 41.9% 19.4%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 38.12 38.12 0.0000 1.5235 24552635.42 24552635.42 0.00 422723.66 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.2 58.12% 380284.80 2676 490592 384284.88 294549 490592 8425726 8425726 0.00
crit 16.0 41.88% 1010061.98 4799 1295162 1020246.96 667628 1295162 16126909 16126909 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 5490 0.6% 0.0 0.00sec 0 0 Periodic 2.8 351492 929863 588460 41.0% 1.5%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 2.79 2.79 0.0000 1.5649 1640708.95 1640708.95 0.00 376223.10 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.6 59.01% 351492.01 4550 490592 162145.75 0 490592 578275 578275 0.00
crit 1.1 40.99% 929862.99 61717 1295162 399354.55 0 1295162 1062434 1062434 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 842 0.1% 0.0 0.00sec 0 0 Periodic 0.4 333961 888231 555718 40.0% 0.2%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.45 0.45 0.0000 1.6024 249789.78 249789.78 0.00 346930.25 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 59.99% 333961.13 32973 490592 31242.11 0 490592 90054 90054 0.00
crit 0.2 40.01% 888230.83 109032 1295162 75795.25 0 1295162 159736 159736 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 78299 / 78299
Doom Bolt 78299 8.4% 119.4 2.50sec 196623 80537 Direct 118.6 161161 322348 197897 22.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.41 118.64 0.00 0.00 2.4414 0.0000 23478086.59 23478086.59 0.00 80536.80 80536.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.60 77.21% 161160.71 133886 231571 161203.37 152571 168900 14761819 14761819 0.00
crit 27.04 22.79% 322348.46 267772 463143 322436.55 292199 354556 8716268 8716268 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Kiljadens_Burning_Wish
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kiljadens_Burning_Wish
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kiljadens_Burning_Wish
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kiljadens_Burning_Wish
  • harmful:false
  • if_expr:
 
Life Tap 10.8 23.87sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 0.00 0.00 0.00 1.2519 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 12.4 24.82sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.44 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.3 156.49sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.29 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
active_uas 22.2 23.9 13.7sec 0.0sec 56.22% 56.22% 0.0(0.0) 0.0

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:29.54%
  • active_uas_2:17.36%
  • active_uas_3:9.09%
  • active_uas_4:0.20%
  • active_uas_5:0.04%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 27.1 37.6 11.0sec 4.6sec 61.03% 100.00% 2.1(2.1) 1.7

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:25.83%
  • compounding_horror_2:16.80%
  • compounding_horror_3:9.71%
  • compounding_horror_4:4.95%
  • compounding_horror_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 12.4 0.0 24.7sec 24.7sec 73.64% 73.64% 0.0(0.0) 11.5

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:73.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.8sec 69.8sec 8.64% 8.64% 0.0(0.0) 3.2

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.64%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.4 0.0 70.1sec 69.2sec 13.42% 13.42% 0.0(0.0) 3.3

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.42%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 165.3sec 0.0sec 38.36% 38.36% 0.0(0.0) 1.9

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:38.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.3 0.0 155.3sec 155.3sec 12.84% 12.84% 0.0(0.0) 2.2

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:12.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 13.1 34.1 23.7sec 6.7sec 75.95% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:22.99%
  • tormented_souls_2:18.61%
  • tormented_souls_3:13.60%
  • tormented_souls_4:9.48%
  • tormented_souls_5:5.49%
  • tormented_souls_6:3.12%
  • tormented_souls_7:1.68%
  • tormented_souls_8:0.55%
  • tormented_souls_9:0.23%
  • tormented_souls_10:0.12%
  • tormented_souls_11:0.05%
  • tormented_souls_12:0.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 5.7 42.2sec
t18_2pc_affliction 46.1 6.5sec
soul_conduit 9.2 29.0sec
souls_consumed 45.6 24.7sec

Resources

Resource Usage Type Count Total Average RPE APR
Kiljadens_Burning_Wish
agony Mana 17.3 570201.5 33000.0 32999.6 69.8
corruption Mana 21.9 724008.0 33000.0 33000.1 48.0
drain_soul Mana 211.7 6987583.4 33000.0 109159.5 4.9
unstable_affliction Soul Shard 46.1 46.1 1.0 1.0 2763143.4
pet - doomguard
doom_bolt Energy 119.4 4179.2 35.0 35.0 5617.8
Resource Gains Type Count Total Average Overflow
life_tap Mana 10.79 3562258.64 (47.84%) 330000.00 0.00 0.00%
agony Soul Shard 34.17 34.17 (77.65%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.59 0.59 (1.33%) 1.00 0.00 0.00%
mp5_regen Mana 274.12 3883256.72 (52.16%) 14166.31 20293.83 0.52%
soul_conduit Soul Shard 9.25 9.25 (21.01%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 191.71 4137.85 (100.00%) 21.58 112.31 2.64%
Resource RPS-Gain RPS-Loss
Health 0.00 12117.69
Mana 24817.56 27605.30
Soul Shard 0.15 0.15
Combat End Resource Mean Min Max
Mana 262916.03 35059.53 476958.07
Soul Shard 0.87 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Kiljadens_Burning_Wish Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Kiljadens_Burning_Wish Damage Per Second
Count 4999
Mean 927292.17
Minimum 773617.48
Maximum 1113545.85
Spread ( max - min ) 339928.36
Range [ ( max - min ) / 2 * 100% ] 18.33%
Standard Deviation 51753.6492
5th Percentile 844883.28
95th Percentile 1015069.93
( 95th Percentile - 5th Percentile ) 170186.65
Mean Distribution
Standard Deviation 731.9803
95.00% Confidence Intervall ( 925857.51 - 928726.82 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 120
0.1% Error 11966
0.1 Scale Factor Error with Delta=300 22864707
0.05 Scale Factor Error with Delta=300 91458825
0.01 Scale Factor Error with Delta=300 2286470612
Priority Target DPS
Sample Data Kiljadens_Burning_Wish Priority Target Damage Per Second
Count 4999
Mean 927292.17
Minimum 773617.48
Maximum 1113545.85
Spread ( max - min ) 339928.36
Range [ ( max - min ) / 2 * 100% ] 18.33%
Standard Deviation 51753.6492
5th Percentile 844883.28
95th Percentile 1015069.93
( 95th Percentile - 5th Percentile ) 170186.65
Mean Distribution
Standard Deviation 731.9803
95.00% Confidence Intervall ( 925857.51 - 928726.82 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 120
0.1% Error 11966
0.1 Scale Factor Error with Delta=300 22864707
0.05 Scale Factor Error with Delta=300 91458825
0.01 Scale Factor Error with Delta=300 2286470612
DPS(e)
Sample Data Kiljadens_Burning_Wish Damage Per Second (Effective)
Count 4999
Mean 927292.17
Minimum 773617.48
Maximum 1113545.85
Spread ( max - min ) 339928.36
Range [ ( max - min ) / 2 * 100% ] 18.33%
Damage
Sample Data Kiljadens_Burning_Wish Damage
Count 4999
Mean 254387384.60
Minimum 169784654.03
Maximum 353639765.35
Spread ( max - min ) 183855111.32
Range [ ( max - min ) / 2 * 100% ] 36.14%
DTPS
Sample Data Kiljadens_Burning_Wish Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Kiljadens_Burning_Wish Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Kiljadens_Burning_Wish Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Kiljadens_Burning_Wish Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Kiljadens_Burning_Wish Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Kiljadens_Burning_Wish Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Kiljadens_Burning_WishTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Kiljadens_Burning_Wish Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 1.44 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 4.57 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
D 2.29 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
E 4.46 use_item,name=kiljaedens_burning_wish
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 0.96 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
G 0.96 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
H 12.71 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
I 10.20 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
J 14.17 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
K 6.81 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
L 5.63 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
M 1.53 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
N 39.15 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
O 8.67 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
P 2.33 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
Q 0.60 life_tap,if=mana.pct<=10
R 50.18 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACEJNNNDORJHNNNRJRHNNNORKRNNRHRJNNRRIRHJNNNORERJRHNRRIRJNRHRIRJNNORCJNNRRIRJHNNPRJERRHINRKRNPRCIJNNNDFRHIJNNNORKRHNNNRKRREIHNRKRNPRHJNRIRNRJRHNNORIRLRGRLRBCRLRGRQR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Kiljadens_Burning_Wish 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Kiljadens_Burning_Wish 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Kiljadens_Burning_Wish 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.319 default E use_item_kiljaedens_burning_wish Fluffy_Pillow 1088506.4/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, potion_of_prolonged_power
0:01.319 default J corruption Fluffy_Pillow 1088506.4/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, potion_of_prolonged_power
0:02.334 default N unstable_affliction Fluffy_Pillow 1072056.0/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, potion_of_prolonged_power
0:03.349 default N unstable_affliction Fluffy_Pillow 1088605.6/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, active_uas, potion_of_prolonged_power
0:04.364 default N unstable_affliction Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), potion_of_prolonged_power
0:05.380 default D soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(3), potion_of_prolonged_power
0:05.380 default O reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, active_uas(3), potion_of_prolonged_power
0:05.380 default R drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), potion_of_prolonged_power
0:11.833 default J corruption Fluffy_Pillow 908216.5/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(4), potion_of_prolonged_power
0:12.847 default H agony Fluffy_Pillow 891749.8/1100000: 81% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(3), compounding_horror(4), potion_of_prolonged_power
0:13.863 default N unstable_affliction Fluffy_Pillow 875315.7/1100000: 80% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(3), compounding_horror(4), potion_of_prolonged_power
0:14.878 default N unstable_affliction Fluffy_Pillow 891865.4/1100000: 81% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(3), active_uas, potion_of_prolonged_power
0:15.892 default N unstable_affliction Fluffy_Pillow 908398.7/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(3), active_uas(2), potion_of_prolonged_power
0:16.907 default R drain_soul Fluffy_Pillow 924948.3/1100000: 84% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(3), active_uas(3), potion_of_prolonged_power
0:25.850 default J corruption Fluffy_Pillow 641764.4/1100000: 58% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(5), compounding_horror, potion_of_prolonged_power
0:26.867 default R drain_soul Fluffy_Pillow 625346.6/1100000: 57% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(5), compounding_horror, potion_of_prolonged_power
0:31.788 default H agony Fluffy_Pillow 474583.8/1100000: 43% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(6), potion_of_prolonged_power
0:32.805 default N unstable_affliction Fluffy_Pillow 458166.0/1100000: 42% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(6), potion_of_prolonged_power
0:33.821 default N unstable_affliction Fluffy_Pillow 474731.9/1100000: 43% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(6), active_uas, potion_of_prolonged_power
0:34.837 default N unstable_affliction Fluffy_Pillow 491297.9/1100000: 45% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(6), active_uas(2), potion_of_prolonged_power
0:35.854 default O reap_souls Fluffy_Pillow 507880.1/1100000: 46% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(6), active_uas(3), potion_of_prolonged_power
0:35.854 default R drain_soul Fluffy_Pillow 507880.1/1100000: 46% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, active_uas(3), potion_of_prolonged_power
0:39.438 default K corruption Fluffy_Pillow 401317.4/1100000: 36% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls, compounding_horror(3), active_uas(2), potion_of_prolonged_power
0:40.453 default R drain_soul Fluffy_Pillow 384867.0/1100000: 35% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls, compounding_horror(3), active_uas, potion_of_prolonged_power
0:42.070 default N unstable_affliction Fluffy_Pillow 339148.0/1100000: 31% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(4), potion_of_prolonged_power
0:43.389 default N unstable_affliction Fluffy_Pillow 355691.4/1100000: 32% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), active_uas, potion_of_prolonged_power
0:44.709 default R drain_soul Fluffy_Pillow 372247.3/1100000: 34% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas, potion_of_prolonged_power
0:49.270 default H agony Fluffy_Pillow 264452.9/1100000: 24% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, potion_of_prolonged_power
0:50.591 default R drain_soul Fluffy_Pillow 248021.4/1100000: 23% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, potion_of_prolonged_power
0:53.460 default J corruption Fluffy_Pillow 185005.3/1100000: 17% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), potion_of_prolonged_power
0:54.781 default N unstable_affliction Fluffy_Pillow 168573.8/1100000: 15% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), potion_of_prolonged_power
0:56.100 default N unstable_affliction Fluffy_Pillow 185117.1/1100000: 17% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas, potion_of_prolonged_power
0:57.420 default R drain_soul Fluffy_Pillow 201673.0/1100000: 18% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), potion_of_prolonged_power
1:01.150 default R drain_soul Fluffy_Pillow 116456.0/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), active_uas(2)
1:03.209 default I life_tap Fluffy_Pillow 76280.7/1100000: 7% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror, active_uas
1:04.529 default R drain_soul Fluffy_Pillow 422836.6/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(2)
1:07.511 default H agony Fluffy_Pillow 361237.9/1100000: 33% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(2)
1:08.831 default J corruption Fluffy_Pillow 344793.8/1100000: 31% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(2)
1:10.150 default N unstable_affliction Fluffy_Pillow 328337.1/1100000: 30% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(2)
1:11.469 default N unstable_affliction Fluffy_Pillow 344880.5/1100000: 31% mana | 2.0/5: 40% soul_shard tormented_souls(4), active_uas
1:12.789 default N unstable_affliction Fluffy_Pillow 361436.4/1100000: 33% mana | 1.0/5: 20% soul_shard tormented_souls(4), active_uas(2)
1:14.107 default O reap_souls Fluffy_Pillow 377967.2/1100000: 34% mana | 0.0/5: 0% soul_shard tormented_souls(4), active_uas(3)
1:14.107 default R drain_soul Fluffy_Pillow 377967.2/1100000: 34% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3)
1:17.120 default E use_item_kiljaedens_burning_wish Fluffy_Pillow 316757.3/1100000: 29% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas(3)
1:17.120 default R drain_soul Fluffy_Pillow 316757.3/1100000: 29% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas(3)
1:21.742 default J corruption Fluffy_Pillow 209728.0/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2)
1:23.063 default R drain_soul Fluffy_Pillow 193296.4/1100000: 18% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2)
1:25.026 default H agony Fluffy_Pillow 151917.1/1100000: 14% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(3)
1:26.345 default N unstable_affliction Fluffy_Pillow 135460.4/1100000: 12% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(3)
1:27.666 default R drain_soul Fluffy_Pillow 152028.9/1100000: 14% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas
1:29.707 default R drain_soul Fluffy_Pillow 111627.8/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas
1:31.731 default I life_tap Fluffy_Pillow 71013.5/1100000: 6% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas
1:33.051 default R drain_soul Fluffy_Pillow 417569.4/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas
1:35.891 default J corruption Fluffy_Pillow 354189.7/1100000: 32% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror
1:37.211 default N unstable_affliction Fluffy_Pillow 337745.6/1100000: 31% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror
1:38.532 default R drain_soul Fluffy_Pillow 354314.0/1100000: 32% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas
1:45.828 default H agony Fluffy_Pillow 148823.0/1100000: 14% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror, nefarious_pact
1:46.731 default R drain_soul Fluffy_Pillow 127148.7/1100000: 12% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror, nefarious_pact
1:48.162 default I life_tap Fluffy_Pillow 79096.8/1100000: 7% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror, nefarious_pact
1:49.064 default R drain_soul Fluffy_Pillow 420410.0/1100000: 38% mana | 2.0/5: 40% soul_shard tormented_souls(3), compounding_horror, nefarious_pact
1:50.551 default J corruption Fluffy_Pillow 373060.5/1100000: 34% mana | 2.0/5: 40% soul_shard tormented_souls(4), nefarious_pact
1:51.454 default N unstable_affliction Fluffy_Pillow 351386.2/1100000: 32% mana | 2.0/5: 40% soul_shard tormented_souls(4), devils_due
1:53.018 default N unstable_affliction Fluffy_Pillow 371002.4/1100000: 34% mana | 1.0/5: 20% soul_shard tormented_souls(4), active_uas, devils_due
1:54.583 default O reap_souls Fluffy_Pillow 390631.2/1100000: 36% mana | 0.0/5: 0% soul_shard tormented_souls(4), active_uas(2), devils_due
1:54.583 default R drain_soul Fluffy_Pillow 390631.2/1100000: 36% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), devils_due
2:03.577 default C agony Fluffy_Pillow 206437.1/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2)
2:04.896 default J corruption Fluffy_Pillow 189980.4/1100000: 17% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2)
2:06.216 default N unstable_affliction Fluffy_Pillow 173536.3/1100000: 16% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2)
2:07.534 default N unstable_affliction Fluffy_Pillow 190067.1/1100000: 17% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas
2:08.854 default R drain_soul Fluffy_Pillow 206623.0/1100000: 19% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2)
2:12.634 default R drain_soul Fluffy_Pillow 122033.1/1100000: 11% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2)
2:14.761 default I life_tap Fluffy_Pillow 82710.7/1100000: 8% mana | 0.0/5: 0% soul_shard tormented_souls(3), compounding_horror, active_uas
2:16.081 default R drain_soul Fluffy_Pillow 429266.6/1100000: 39% mana | 0.0/5: 0% soul_shard tormented_souls(3), compounding_horror
2:18.136 default J corruption Fluffy_Pillow 389041.1/1100000: 35% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror
2:19.456 default H agony Fluffy_Pillow 372597.0/1100000: 34% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror
2:20.778 default N unstable_affliction Fluffy_Pillow 356178.0/1100000: 32% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror
2:22.097 default N unstable_affliction Fluffy_Pillow 372721.3/1100000: 34% mana | 1.0/5: 20% soul_shard tormented_souls(4), active_uas
2:23.414 default P reap_souls Fluffy_Pillow 389239.6/1100000: 35% mana | 0.0/5: 0% soul_shard tormented_souls(4), active_uas
2:23.414 default R drain_soul Fluffy_Pillow 389239.6/1100000: 35% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas
2:31.474 default J corruption Fluffy_Pillow 193330.9/1100000: 18% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(3)
2:32.794 default E use_item_kiljaedens_burning_wish Fluffy_Pillow 176886.8/1100000: 16% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(4)
2:32.794 default R drain_soul Fluffy_Pillow 176886.8/1100000: 16% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(4)
2:35.648 default R drain_soul Fluffy_Pillow 113682.7/1100000: 10% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(5)
2:37.712 default H agony Fluffy_Pillow 73570.1/1100000: 7% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(5)
2:39.033 default I life_tap Fluffy_Pillow 57138.5/1100000: 5% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(5)
2:40.351 default N unstable_affliction Fluffy_Pillow 403669.3/1100000: 37% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(5)
2:41.671 default R drain_soul Fluffy_Pillow 420225.2/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), active_uas
2:45.435 default K corruption Fluffy_Pillow 335434.6/1100000: 30% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror(2), active_uas
2:46.753 default R drain_soul Fluffy_Pillow 318965.4/1100000: 29% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror(2), active_uas
2:48.769 default N unstable_affliction Fluffy_Pillow 278250.8/1100000: 25% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror(2)
2:50.088 default P reap_souls Fluffy_Pillow 294794.2/1100000: 27% mana | 2.0/5: 40% soul_shard tormented_souls(6), active_uas
2:50.088 default R drain_soul Fluffy_Pillow 294794.2/1100000: 27% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas
2:57.278 default C agony Fluffy_Pillow 120973.6/1100000: 11% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror
2:58.598 default I life_tap Fluffy_Pillow 104529.5/1100000: 10% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror
2:59.918 default J corruption Fluffy_Pillow 451085.4/1100000: 41% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2)
3:01.238 default N unstable_affliction Fluffy_Pillow 434641.3/1100000: 40% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2)
3:02.557 default N unstable_affliction Fluffy_Pillow 451184.7/1100000: 41% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), active_uas, nefarious_pact
3:03.459 default N unstable_affliction Fluffy_Pillow 462497.9/1100000: 42% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), nefarious_pact
3:04.362 default D soul_harvest Fluffy_Pillow 473823.6/1100000: 43% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas(3), nefarious_pact
3:04.362 default F potion Fluffy_Pillow 473823.6/1100000: 43% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), active_uas(3), nefarious_pact
3:04.362 default R drain_soul Fluffy_Pillow 473823.6/1100000: 43% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), active_uas(3), nefarious_pact, potion_of_prolonged_power
3:12.998 default H agony Fluffy_Pillow 120139.3/1100000: 11% mana | 3.0/5: 60% soul_shard soul_harvest, deadwind_harvester, tormented_souls(6), compounding_horror(4), nefarious_pact, potion_of_prolonged_power
3:13.901 default I life_tap Fluffy_Pillow 98465.1/1100000: 9% mana | 3.0/5: 60% soul_shard soul_harvest, deadwind_harvester, tormented_souls(6), compounding_horror(4), devils_due, potion_of_prolonged_power
3:15.468 default J corruption Fluffy_Pillow 448118.9/1100000: 41% mana | 3.0/5: 60% soul_shard soul_harvest, deadwind_harvester, tormented_souls(6), compounding_horror(5), devils_due, potion_of_prolonged_power
3:17.031 default N unstable_affliction Fluffy_Pillow 434722.6/1100000: 40% mana | 3.0/5: 60% soul_shard soul_harvest, deadwind_harvester, tormented_souls(6), compounding_horror(5), devils_due, potion_of_prolonged_power
3:18.597 default N unstable_affliction Fluffy_Pillow 454363.9/1100000: 41% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls(6), active_uas, devils_due, potion_of_prolonged_power
3:20.162 default N unstable_affliction Fluffy_Pillow 473992.7/1100000: 43% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(7), active_uas(2), devils_due, potion_of_prolonged_power
3:21.726 default O reap_souls Fluffy_Pillow 493608.9/1100000: 45% mana | 0.0/5: 0% soul_shard tormented_souls(7), active_uas(3), devils_due, potion_of_prolonged_power
3:21.726 default R drain_soul Fluffy_Pillow 493608.9/1100000: 45% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), devils_due, potion_of_prolonged_power
3:29.095 default K corruption Fluffy_Pillow 355033.5/1100000: 32% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, active_uas, potion_of_prolonged_power
3:30.415 default R drain_soul Fluffy_Pillow 338589.4/1100000: 31% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror, potion_of_prolonged_power
3:32.418 default H agony Fluffy_Pillow 297711.7/1100000: 27% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), potion_of_prolonged_power
3:33.739 default N unstable_affliction Fluffy_Pillow 281280.1/1100000: 26% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), potion_of_prolonged_power
3:35.060 default N unstable_affliction Fluffy_Pillow 297848.6/1100000: 27% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas, potion_of_prolonged_power
3:36.378 default N unstable_affliction Fluffy_Pillow 314379.4/1100000: 29% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(2), potion_of_prolonged_power
3:37.698 default R drain_soul Fluffy_Pillow 330935.3/1100000: 30% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), potion_of_prolonged_power
3:41.432 default K corruption Fluffy_Pillow 245768.4/1100000: 22% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas(3), potion_of_prolonged_power
3:42.752 default R drain_soul Fluffy_Pillow 229324.3/1100000: 21% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, active_uas(2), potion_of_prolonged_power
3:46.381 default R drain_soul Fluffy_Pillow 142840.5/1100000: 13% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, potion_of_prolonged_power
3:48.434 default E use_item_kiljaedens_burning_wish Fluffy_Pillow 102589.9/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), potion_of_prolonged_power
3:48.434 default I life_tap Fluffy_Pillow 102589.9/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), potion_of_prolonged_power
3:49.755 default H agony Fluffy_Pillow 449158.4/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), potion_of_prolonged_power
3:51.074 default N unstable_affliction Fluffy_Pillow 432701.7/1100000: 39% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), potion_of_prolonged_power
3:52.393 default R drain_soul Fluffy_Pillow 449245.1/1100000: 41% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, potion_of_prolonged_power
3:56.183 default K corruption Fluffy_Pillow 364780.6/1100000: 33% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas, potion_of_prolonged_power
3:57.504 default R drain_soul Fluffy_Pillow 348349.0/1100000: 32% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas, potion_of_prolonged_power
3:59.444 default N unstable_affliction Fluffy_Pillow 306681.1/1100000: 28% mana | 1.0/5: 20% soul_shard tormented_souls(4), potion_of_prolonged_power
4:00.766 default P reap_souls Fluffy_Pillow 323262.1/1100000: 29% mana | 0.0/5: 0% soul_shard tormented_souls(4), active_uas, potion_of_prolonged_power
4:00.766 default R drain_soul Fluffy_Pillow 323262.1/1100000: 29% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, potion_of_prolonged_power
4:07.969 default H agony Fluffy_Pillow 149604.7/1100000: 14% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror
4:09.287 default J corruption Fluffy_Pillow 133135.5/1100000: 12% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror
4:10.606 default N unstable_affliction Fluffy_Pillow 116678.8/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror
4:11.924 default R drain_soul Fluffy_Pillow 133209.6/1100000: 12% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas
4:13.916 default I life_tap Fluffy_Pillow 92194.0/1100000: 8% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas
4:15.235 default R drain_soul Fluffy_Pillow 438737.3/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, active_uas
4:17.187 default N unstable_affliction Fluffy_Pillow 397220.0/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), active_uas
4:18.506 default R drain_soul Fluffy_Pillow 413763.4/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), nefarious_pact
4:23.564 default J corruption Fluffy_Pillow 213202.5/1100000: 19% mana | 1.0/5: 20% soul_shard tormented_souls(3), nefarious_pact
4:24.468 default R drain_soul Fluffy_Pillow 191540.8/1100000: 17% mana | 1.0/5: 20% soul_shard tormented_souls(3), nefarious_pact
4:25.904 default H agony Fluffy_Pillow 143551.6/1100000: 13% mana | 1.0/5: 20% soul_shard tormented_souls(3), nefarious_pact
4:26.805 default N unstable_affliction Fluffy_Pillow 121852.3/1100000: 11% mana | 1.0/5: 20% soul_shard tormented_souls(3), nefarious_pact
4:27.705 default N unstable_affliction Fluffy_Pillow 133140.4/1100000: 12% mana | 1.0/5: 20% soul_shard tormented_souls(3), active_uas, nefarious_pact
4:28.607 default O reap_souls Fluffy_Pillow 144453.6/1100000: 13% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas(2), nefarious_pact
4:28.607 default R drain_soul Fluffy_Pillow 144453.6/1100000: 13% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), nefarious_pact
4:29.904 default I life_tap Fluffy_Pillow 94721.0/1100000: 9% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), nefarious_pact
4:30.806 default R drain_soul Fluffy_Pillow 436034.2/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), devils_due
4:33.144 default L unstable_affliction Fluffy_Pillow 399358.2/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, devils_due
4:34.711 default R drain_soul Fluffy_Pillow 419012.1/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, devils_due
4:38.140 default G corruption Fluffy_Pillow 363019.8/1100000: 33% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, devils_due
4:39.704 default R drain_soul Fluffy_Pillow 349636.0/1100000: 32% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), active_uas
4:41.670 default L unstable_affliction Fluffy_Pillow 308294.3/1100000: 28% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), active_uas
4:42.988 default R drain_soul Fluffy_Pillow 324825.1/1100000: 30% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2)
4:45.801 default B reap_souls Fluffy_Pillow 261106.7/1100000: 24% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas
4:45.801 default C agony Fluffy_Pillow 261106.7/1100000: 24% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas
4:47.121 default R drain_soul Fluffy_Pillow 244662.6/1100000: 22% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas
4:49.139 default L unstable_affliction Fluffy_Pillow 203973.1/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), active_uas
4:50.459 default R drain_soul Fluffy_Pillow 220529.0/1100000: 20% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas
4:52.453 default G corruption Fluffy_Pillow 179538.4/1100000: 16% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas
4:53.772 default R drain_soul Fluffy_Pillow 163081.8/1100000: 15% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas
4:56.643 default Q life_tap Fluffy_Pillow 100090.8/1100000: 9% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas
4:57.962 default R drain_soul Fluffy_Pillow 446634.2/1100000: 41% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 55168 55168 34531
Intellect 51490 49784 40086 (4272)
Spirit 0 0 0
Health 3310080 3310080 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 51490 49784 0
Crit 22.78% 22.78% 7110
Haste 14.02% 14.02% 5258
Damage / Heal Versatility 2.33% 2.33% 1107
ManaReg per Second 12542 12542 0
Mastery 125.03% 122.06% 12422
Armor 1983 1983 1983
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 910.00
Local Head Eyes of Azj'Aqir
ilevel: 905, stats: { 257 Armor, +3410 Sta, +2273 Int, +1094 Haste, +589 Vers }
Local Neck Beleron's Choker of Misery
ilevel: 905, stats: { +1918 Sta, +1727 Crit, +1295 Mastery }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Master Warmage's Leggings
ilevel: 905, stats: { 277 Armor, +3410 Sta, +2273 Int, +914 Mastery, +769 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Bracers of Harnessed Flame
ilevel: 905, stats: { 139 Armor, +1918 Sta, +1278 Int, +595 Mastery, +351 Crit }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Spellblade's Gemmed Signet
ilevel: 905, stats: { +1918 Sta, +2073 Crit, +950 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Kil'jaeden's Burning Wish
ilevel: 940, stats: { +2994 StrAgiInt, +456 Crit, +456 Mastery, +456 Haste }
Local Back Cloak of Temporal Recalibration
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +636 Mastery, +311 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Kiljadens_Burning_Wish"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/use_item,name=kiljaedens_burning_wish
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3518
neck=belerons_choker_of_misery,id=140899,bonus_id=3518,enchant=mark_of_the_trained_soldier
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518
back=cloak_of_temporal_recalibration,id=140910,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3518
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518
legs=master_warmages_leggings,id=140852,bonus_id=3518
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=spellblades_gemmed_signet,id=140895,bonus_id=3518,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=kiljaedens_burning_wish,id=144259,ilevel=940
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=909.93
# gear_stamina=34531
# gear_intellect=40086
# gear_crit_rating=6971
# gear_haste_rating=5155
# gear_mastery_rating=12178
# gear_versatility_rating=1085
# gear_armor=1983
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Norgannons_Foresight : 926697 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
926696.8 926696.8 1425.2 / 0.154% 200663.6 / 21.7% 29.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
28752.6 28752.6 Mana 0.00% 32.7 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Norgannons_Foresight 926697
Agony 134192 14.5% 17.3 18.10sec 2329404 1923948 Periodic 193.0 142782 377957 208516 27.9% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.27 0.00 192.96 192.96 1.2108 1.5505 40233600.27 40233600.27 0.00 125689.94 1923947.99
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 139.0 72.05% 142781.72 13442 238186 142806.02 123522 158878 19850389 19850389 0.00
crit 53.9 27.95% 377956.54 31185 628810 377901.44 302240 440724 20383212 20383212 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 6438 0.7% 25.7 11.47sec 74990 0 Direct 25.7 61892 123881 74993 21.1%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.75 25.75 0.00 0.00 0.0000 0.0000 1930779.90 1930779.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.31 78.87% 61892.48 19913 191767 62084.46 35417 95642 1256856 1256856 0.00
crit 5.44 21.13% 123881.44 39826 383535 123379.62 0 297944 673924 673924 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 117391 12.7% 21.9 13.85sec 1604208 1355708 Periodic 192.5 125188 330725 182838 28.0% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 0.00 192.48 192.48 1.1833 1.5475 35191480.33 35191480.33 0.00 108677.06 1355708.46
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 138.5 71.95% 125188.29 662 204492 125233.36 108449 137447 17337386 17337386 0.00
crit 54.0 28.05% 330724.88 316 539858 330744.10 251462 389428 17854094 17854094 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 117847 12.7% 65.2 4.56sec 541851 192235 Periodic 222.2 123429 249268 158988 28.3% 57.1%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.19 0.00 222.19 222.19 2.8187 0.7709 35325002.67 35325002.67 0.00 192235.50 192235.50
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 159.4 71.74% 123429.33 79156 161087 123490.33 112432 132103 19674871 19674871 0.00
crit 62.8 28.26% 249268.29 158312 322174 249369.60 220541 272643 15650132 15650132 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 24465 2.6% 50.7 5.79sec 144532 0 Direct 50.5 120023 240005 145192 21.0%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.75 50.52 0.00 0.00 0.0000 0.0000 7334543.57 7334543.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.92 79.02% 120022.88 80898 155813 120011.57 107295 130570 4791030 4791030 0.00
crit 10.60 20.98% 240005.33 161797 311626 240008.77 176288 291509 2543514 2543514 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Soul 18737 2.0% 16.3 17.16sec 343809 0 Direct 16.3 284722 568931 343833 20.8%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.33 16.33 0.00 0.00 0.0000 0.0000 5614701.51 5614701.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.94 79.21% 284722.35 186686 359564 284483.05 224108 353710 3683060 3683060 0.00
crit 3.40 20.79% 568930.66 373371 719128 544485.04 0 719128 1931641 1931641 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (427967) 0.0% (46.2%) 47.8 6.24sec 2683159 2298598

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.79 0.00 0.00 0.00 1.1673 0.0000 0.00 0.00 0.00 2298597.91 2298597.91
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 189265 20.4% 0.0 0.00sec 0 0 Periodic 109.7 311772 833640 517526 39.4% 50.6%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 109.68 109.68 0.0000 1.3847 56762449.47 56762449.47 0.00 373734.68 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.4 60.58% 311771.84 157 482745 312213.80 261264 363294 20714026 20714026 0.00
crit 43.2 39.42% 833640.26 618 1274446 834727.18 653838 1005986 36048423 36048423 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 148891 16.1% 0.0 0.00sec 0 0 Periodic 81.1 330643 879336 550037 40.0% 37.0%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 81.12 81.12 0.0000 1.3682 44617415.45 44617415.45 0.00 402005.78 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.7 60.02% 330642.93 266 482745 331578.26 265209 400782 16098114 16098114 0.00
crit 32.4 39.98% 879335.82 720 1274446 881433.13 642054 1072132 28519301 28519301 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 83358 9.0% 0.0 0.00sec 0 0 Periodic 44.0 339447 903640 566170 40.2% 19.6%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 44.01 44.01 0.0000 1.3358 24918610.00 24918610.00 0.00 423829.13 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.3 59.82% 339447.22 199 482745 342861.51 0 482745 8936398 8936398 0.00
crit 17.7 40.18% 903639.75 509 1274446 912016.88 521571 1274446 15982212 15982212 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 5547 0.6% 0.0 0.00sec 0 0 Periodic 3.2 314202 834319 525026 40.5% 1.4%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 3.15 3.15 0.0000 1.3777 1655226.59 1655226.59 0.00 381037.43 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.9 59.48% 314201.72 910 482745 149045.71 0 482745 589309 589309 0.00
crit 1.3 40.52% 834318.51 2444 1274446 375994.80 0 1274446 1065918 1065918 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 906 0.1% 0.0 0.00sec 0 0 Periodic 0.5 295206 808390 501552 40.2% 0.3%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.54 0.54 0.0000 1.4012 268985.89 268985.89 0.00 358170.29 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 59.79% 295206.38 1543 482745 29874.62 0 482745 94662 94662 0.00
crit 0.2 40.21% 808390.18 1454 1274446 75322.96 0 1274446 174324 174324 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 79660 / 79660
Doom Bolt 79660 8.6% 123.9 2.41sec 192817 81983 Direct 123.1 160381 320856 194072 21.0%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.86 123.06 0.00 0.00 2.3519 0.0000 23882208.27 23882208.27 0.00 81983.24 81983.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.22 79.00% 160380.90 132916 229975 160417.80 151644 167618 15592166 15592166 0.00
crit 25.84 21.00% 320856.46 265833 459950 320905.83 287866 359702 8290042 8290042 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Norgannons_Foresight
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Norgannons_Foresight
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Norgannons_Foresight
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Norgannons_Foresight
  • harmful:false
  • if_expr:
 
Life Tap 11.4 22.77sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.39 0.00 0.00 0.00 1.2014 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 12.4 24.91sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.37 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.3 153.15sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.30 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.8 0.0 15.5sec 15.5sec 77.88% 77.88% 2.1(2.1) 19.1

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.11%
  • accelerando_2:23.60%
  • accelerando_3:14.45%
  • accelerando_4:6.92%
  • accelerando_5:3.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 22.7 25.0 13.4sec 0.0sec 55.99% 55.99% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:29.03%
  • active_uas_2:17.34%
  • active_uas_3:9.38%
  • active_uas_4:0.20%
  • active_uas_5:0.05%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 27.9 39.8 10.7sec 4.4sec 61.53% 100.00% 2.3(2.3) 1.5

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:25.66%
  • compounding_horror_2:16.90%
  • compounding_horror_3:9.93%
  • compounding_horror_4:5.13%
  • compounding_horror_5:3.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 12.4 0.0 24.9sec 24.9sec 74.97% 74.97% 0.0(0.0) 11.4

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:74.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 69.1sec 69.1sec 8.77% 8.77% 0.0(0.0) 3.2

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.77%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.5 0.0 69.4sec 68.6sec 13.62% 13.62% 0.0(0.0) 3.3

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.62%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Norgannon's Foresight (_ready) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_norgannons_foresight_ready
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • norgannons_foresight_ready_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:236380
  • name:Norgannon's Foresight
  • tooltip:Your spells may be castable while moving.
  • description:{$@spelldesc236373=Standing still for {$234797d=6 seconds} grants you Foresight, allowing you to cast while moving for ${{$236380s1=4000}/1000} sec. This duration begins when you start moving.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 164.1sec 0.0sec 38.47% 38.47% 0.0(0.0) 1.9

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:38.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.3 0.0 154.0sec 154.0sec 12.91% 12.91% 0.0(0.0) 2.3

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:12.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 13.1 35.2 23.8sec 6.6sec 76.71% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:22.46%
  • tormented_souls_2:18.45%
  • tormented_souls_3:13.81%
  • tormented_souls_4:9.80%
  • tormented_souls_5:5.82%
  • tormented_souls_6:3.38%
  • tormented_souls_7:1.85%
  • tormented_souls_8:0.67%
  • tormented_souls_9:0.26%
  • tormented_souls_10:0.12%
  • tormented_souls_11:0.05%
  • tormented_souls_12:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 6.0 41.3sec
t18_2pc_affliction 47.8 6.2sec
soul_conduit 9.6 28.2sec
souls_consumed 46.5 24.9sec

Resources

Resource Usage Type Count Total Average RPE APR
Norgannons_Foresight
agony Mana 17.3 569970.6 33000.0 32999.6 70.6
corruption Mana 21.9 723922.2 33000.0 33000.1 48.6
drain_soul Mana 222.2 7332160.7 33000.0 112468.1 4.8
unstable_affliction Soul Shard 47.8 47.8 1.0 1.0 2683160.7
pet - doomguard
doom_bolt Energy 123.9 4335.1 35.0 35.0 5509.1
Resource Gains Type Count Total Average Overflow
life_tap Mana 11.39 3758622.83 (48.20%) 330000.00 0.00 0.00%
agony Soul Shard 35.52 35.52 (77.78%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.59 0.59 (1.29%) 1.00 0.00 0.00%
mp5_regen Mana 351.40 4040130.78 (51.80%) 11497.28 21736.77 0.54%
soul_conduit Soul Shard 9.56 9.56 (20.93%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 198.79 4293.83 (100.00%) 21.60 119.96 2.72%
Resource RPS-Gain RPS-Loss
Health 0.00 13059.15
Mana 25994.84 28752.64
Soul Shard 0.15 0.16
Combat End Resource Mean Min Max
Mana 274063.54 40772.64 500229.86
Soul Shard 0.88 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Norgannons_Foresight Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Norgannons_Foresight Damage Per Second
Count 4999
Mean 926696.77
Minimum 766654.99
Maximum 1146242.96
Spread ( max - min ) 379587.98
Range [ ( max - min ) / 2 * 100% ] 20.48%
Standard Deviation 51412.5945
5th Percentile 844034.96
95th Percentile 1013044.66
( 95th Percentile - 5th Percentile ) 169009.70
Mean Distribution
Standard Deviation 727.1566
95.00% Confidence Intervall ( 925271.57 - 928121.97 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 119
0.1% Error 11824
0.1 Scale Factor Error with Delta=300 22564344
0.05 Scale Factor Error with Delta=300 90257376
0.01 Scale Factor Error with Delta=300 2256434393
Priority Target DPS
Sample Data Norgannons_Foresight Priority Target Damage Per Second
Count 4999
Mean 926696.77
Minimum 766654.99
Maximum 1146242.96
Spread ( max - min ) 379587.98
Range [ ( max - min ) / 2 * 100% ] 20.48%
Standard Deviation 51412.5945
5th Percentile 844034.96
95th Percentile 1013044.66
( 95th Percentile - 5th Percentile ) 169009.70
Mean Distribution
Standard Deviation 727.1566
95.00% Confidence Intervall ( 925271.57 - 928121.97 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 119
0.1% Error 11824
0.1 Scale Factor Error with Delta=300 22564344
0.05 Scale Factor Error with Delta=300 90257376
0.01 Scale Factor Error with Delta=300 2256434393
DPS(e)
Sample Data Norgannons_Foresight Damage Per Second (Effective)
Count 4999
Mean 926696.77
Minimum 766654.99
Maximum 1146242.96
Spread ( max - min ) 379587.98
Range [ ( max - min ) / 2 * 100% ] 20.48%
Damage
Sample Data Norgannons_Foresight Damage
Count 4999
Mean 253852795.63
Minimum 167199957.63
Maximum 353657122.86
Spread ( max - min ) 186457165.23
Range [ ( max - min ) / 2 * 100% ] 36.73%
DTPS
Sample Data Norgannons_Foresight Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Norgannons_Foresight Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Norgannons_Foresight Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Norgannons_Foresight Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Norgannons_Foresight Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Norgannons_Foresight Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Norgannons_ForesightTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Norgannons_Foresight Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 1.50 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 4.37 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
D 2.30 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
E 0.96 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 0.78 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
G 12.90 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
H 10.78 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
I 14.73 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
J 6.43 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
K 5.86 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
L 1.71 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
M 40.40 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
N 8.68 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
O 2.19 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
P 0.61 life_tap,if=mana.pct<=10
Q 49.26 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACIMMMDNQIQGLMMQIQGMMMNQJQMMQCQHIMMMNQQCHILMMQJQGMMMNQJHMQGQLQIQHQLKNQCJLKMDEQLQQJGLMMNQQHIQGLMMNQJQQGHLOQJQMMMQQGHIMMMNQJQGMMMNQHIMMMQNQGMQJQMMQNQHQCIMMMDQNQGIMMMKNQKQFQHGKQBQFQK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Norgannons_Foresight 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Norgannons_Foresight 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Norgannons_Foresight 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.308 default I corruption Fluffy_Pillow 1088887.1/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:02.299 default M unstable_affliction Fluffy_Pillow 1072469.8/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:03.289 default M unstable_affliction Fluffy_Pillow 1089035.8/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, accelerando, potion_of_prolonged_power
0:04.279 default M unstable_affliction Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), accelerando, potion_of_prolonged_power
0:05.270 default D soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(3), accelerando, potion_of_prolonged_power
0:05.270 default N reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, active_uas(3), accelerando, potion_of_prolonged_power
0:05.270 default Q drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
0:11.461 default I corruption Fluffy_Pillow 907994.5/1100000: 83% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, compounding_horror, accelerando(2), potion_of_prolonged_power
0:12.435 default Q drain_soul Fluffy_Pillow 891322.2/1100000: 81% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, compounding_horror, potion_of_prolonged_power
0:13.973 default G agony Fluffy_Pillow 850618.2/1100000: 77% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, compounding_horror(2), potion_of_prolonged_power
0:14.980 default L unstable_affliction Fluffy_Pillow 834180.6/1100000: 76% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, deadwind_harvester, compounding_horror(2), potion_of_prolonged_power
0:15.987 default M unstable_affliction Fluffy_Pillow 850743.0/1100000: 77% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas, potion_of_prolonged_power
0:16.993 default M unstable_affliction Fluffy_Pillow 867523.5/1100000: 79% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas(2), accelerando, potion_of_prolonged_power
0:17.983 default Q drain_soul Fluffy_Pillow 884089.4/1100000: 80% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas(3), accelerando, potion_of_prolonged_power
0:25.383 default I corruption Fluffy_Pillow 648912.7/1100000: 59% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(3), compounding_horror, accelerando(5), potion_of_prolonged_power
0:26.310 default Q drain_soul Fluffy_Pillow 632483.5/1100000: 57% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(3), compounding_horror(2), accelerando(5), potion_of_prolonged_power
0:30.827 default G agony Fluffy_Pillow 478968.8/1100000: 44% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls(3), compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:31.801 default M unstable_affliction Fluffy_Pillow 462545.3/1100000: 42% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls(3), compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:32.775 default M unstable_affliction Fluffy_Pillow 479121.7/1100000: 44% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(3), active_uas, accelerando(2), potion_of_prolonged_power
0:33.750 default M unstable_affliction Fluffy_Pillow 495715.1/1100000: 45% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(3), active_uas(2), accelerando(2), potion_of_prolonged_power
0:34.723 default N reap_souls Fluffy_Pillow 512274.5/1100000: 47% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(3), active_uas(3), accelerando(2), potion_of_prolonged_power
0:34.723 default Q drain_soul Fluffy_Pillow 512274.5/1100000: 47% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, active_uas(3), accelerando(2), potion_of_prolonged_power
0:39.574 default J corruption Fluffy_Pillow 366071.9/1100000: 33% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, compounding_horror(2), active_uas, accelerando(5), potion_of_prolonged_power
0:40.502 default Q drain_soul Fluffy_Pillow 349660.6/1100000: 32% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, compounding_horror(2), accelerando(5), potion_of_prolonged_power
0:41.927 default M unstable_affliction Fluffy_Pillow 303109.0/1100000: 28% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror(2), potion_of_prolonged_power
0:43.236 default M unstable_affliction Fluffy_Pillow 319670.2/1100000: 29% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas, potion_of_prolonged_power
0:44.545 default Q drain_soul Fluffy_Pillow 336231.4/1100000: 31% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(2), potion_of_prolonged_power
0:51.689 default C agony Fluffy_Pillow 163996.0/1100000: 15% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror(2), nefarious_pact, accelerando, potion_of_prolonged_power
0:52.568 default Q drain_soul Fluffy_Pillow 142310.3/1100000: 13% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror(2), nefarious_pact, accelerando, potion_of_prolonged_power
0:53.985 default H life_tap Fluffy_Pillow 94586.7/1100000: 9% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror(2), nefarious_pact, accelerando(2), potion_of_prolonged_power
0:54.850 default I corruption Fluffy_Pillow 435910.8/1100000: 40% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror(2), nefarious_pact, accelerando(2), potion_of_prolonged_power
0:55.714 default M unstable_affliction Fluffy_Pillow 414495.8/1100000: 38% mana | 2.0/5: 40% soul_shard tormented_souls(5), compounding_horror(2), nefarious_pact, accelerando(4), potion_of_prolonged_power
0:56.551 default M unstable_affliction Fluffy_Pillow 425821.2/1100000: 39% mana | 2.0/5: 40% soul_shard tormented_souls(5), active_uas, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:57.388 default M unstable_affliction Fluffy_Pillow 437227.6/1100000: 40% mana | 2.0/5: 40% soul_shard tormented_souls(5), active_uas, nefarious_pact, accelerando(5), potion_of_prolonged_power
0:58.211 default N reap_souls Fluffy_Pillow 447668.6/1100000: 41% mana | 2.0/5: 40% soul_shard tormented_souls(6), active_uas(2), nefarious_pact
0:58.211 default Q drain_soul Fluffy_Pillow 447668.6/1100000: 41% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(2), nefarious_pact
1:06.586 default Q drain_soul Fluffy_Pillow 127222.4/1100000: 12% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, devils_due, accelerando(2)
1:08.892 default C agony Fluffy_Pillow 92164.7/1100000: 8% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), devils_due, accelerando(4)
1:10.344 default H life_tap Fluffy_Pillow 79024.9/1100000: 7% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), devils_due, accelerando(5)
1:11.772 default I corruption Fluffy_Pillow 427235.5/1100000: 39% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3)
1:13.081 default L unstable_affliction Fluffy_Pillow 411084.7/1100000: 37% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), accelerando
1:14.366 default M unstable_affliction Fluffy_Pillow 427625.8/1100000: 39% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(4), active_uas, accelerando(2)
1:15.630 default M unstable_affliction Fluffy_Pillow 444174.3/1100000: 40% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), active_uas(2), accelerando(3)
1:16.874 default Q drain_soul Fluffy_Pillow 460733.4/1100000: 42% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), active_uas(3), accelerando(3)
1:22.795 default J corruption Fluffy_Pillow 308943.6/1100000: 28% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror, active_uas, accelerando(4)
1:24.017 default Q drain_soul Fluffy_Pillow 292430.4/1100000: 27% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror
1:26.090 default G agony Fluffy_Pillow 252657.5/1100000: 23% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror
1:27.399 default M unstable_affliction Fluffy_Pillow 236218.7/1100000: 21% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror
1:28.707 default M unstable_affliction Fluffy_Pillow 252898.3/1100000: 23% mana | 2.0/5: 40% soul_shard tormented_souls(5), active_uas, accelerando
1:29.991 default M unstable_affliction Fluffy_Pillow 269425.6/1100000: 24% mana | 3.0/5: 60% soul_shard tormented_souls(5), active_uas(2), accelerando
1:31.276 default N reap_souls Fluffy_Pillow 285965.8/1100000: 26% mana | 2.0/5: 40% soul_shard tormented_souls(5), active_uas(3), accelerando
1:31.276 default Q drain_soul Fluffy_Pillow 285965.8/1100000: 26% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(3), accelerando
1:37.154 default J corruption Fluffy_Pillow 130698.5/1100000: 12% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), active_uas, nefarious_pact, accelerando(2)
1:38.020 default H life_tap Fluffy_Pillow 109035.7/1100000: 10% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), active_uas, nefarious_pact, accelerando(2)
1:38.885 default M unstable_affliction Fluffy_Pillow 450362.7/1100000: 41% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), nefarious_pact, accelerando(3)
1:39.735 default Q drain_soul Fluffy_Pillow 461677.2/1100000: 42% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, active_uas, nefarious_pact, accelerando(3)
1:44.467 default G agony Fluffy_Pillow 257793.3/1100000: 23% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror, nefarious_pact
1:45.361 default Q drain_soul Fluffy_Pillow 236104.0/1100000: 21% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror, nefarious_pact
1:47.349 default L unstable_affliction Fluffy_Pillow 162255.7/1100000: 15% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), devils_due
1:48.901 default Q drain_soul Fluffy_Pillow 182132.5/1100000: 17% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, active_uas, devils_due, accelerando
1:51.209 default I corruption Fluffy_Pillow 146634.8/1100000: 13% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, devils_due, accelerando(4)
1:52.661 default Q drain_soul Fluffy_Pillow 133281.6/1100000: 12% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, devils_due, accelerando(4)
1:54.894 default H life_tap Fluffy_Pillow 97986.7/1100000: 9% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, accelerando(5)
1:56.097 default Q drain_soul Fluffy_Pillow 444528.6/1100000: 40% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(5)
1:57.899 default L unstable_affliction Fluffy_Pillow 403307.2/1100000: 37% mana | 4.0/5: 80% soul_shard tormented_souls, compounding_horror(2), accelerando(5)
1:59.104 default K unstable_affliction Fluffy_Pillow 419876.7/1100000: 38% mana | 4.0/5: 80% soul_shard tormented_souls(2), active_uas, accelerando(5)
2:00.306 default N reap_souls Fluffy_Pillow 435853.3/1100000: 40% mana | 3.0/5: 60% soul_shard tormented_souls(2), active_uas(2)
2:00.306 default Q drain_soul Fluffy_Pillow 435853.3/1100000: 40% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(2)
2:04.012 default C agony Fluffy_Pillow 350740.7/1100000: 32% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror, active_uas
2:05.321 default J corruption Fluffy_Pillow 334401.0/1100000: 30% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror, active_uas, accelerando
2:06.606 default L unstable_affliction Fluffy_Pillow 317941.3/1100000: 29% mana | 4.0/5: 80% soul_shard deadwind_harvester, compounding_horror, accelerando
2:07.891 default K unstable_affliction Fluffy_Pillow 334481.5/1100000: 30% mana | 4.0/5: 80% soul_shard deadwind_harvester, active_uas, accelerando
2:09.178 default M unstable_affliction Fluffy_Pillow 351047.4/1100000: 32% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(2), accelerando
2:10.464 default D soul_harvest Fluffy_Pillow 367791.2/1100000: 33% mana | 3.0/5: 60% soul_shard active_uas(3), accelerando(2)
2:10.464 default E potion Fluffy_Pillow 367791.2/1100000: 33% mana | 3.0/5: 60% soul_shard soul_harvest, active_uas(3), accelerando(2)
2:10.464 default Q drain_soul Fluffy_Pillow 367791.2/1100000: 33% mana | 3.0/5: 60% soul_shard soul_harvest, active_uas(3), accelerando(2), potion_of_prolonged_power
2:12.425 default L unstable_affliction Fluffy_Pillow 327709.9/1100000: 30% mana | 4.0/5: 80% soul_shard soul_harvest, active_uas(3), accelerando(3), potion_of_prolonged_power
2:13.669 default Q drain_soul Fluffy_Pillow 344269.0/1100000: 31% mana | 3.0/5: 60% soul_shard soul_harvest, active_uas(4), accelerando(3), potion_of_prolonged_power
2:17.241 default Q drain_soul Fluffy_Pillow 259913.3/1100000: 24% mana | 3.0/5: 60% soul_shard soul_harvest, tormented_souls, active_uas, potion_of_prolonged_power
2:19.256 default J corruption Fluffy_Pillow 219406.6/1100000: 20% mana | 4.0/5: 80% soul_shard soul_harvest, tormented_souls(2), active_uas, potion_of_prolonged_power
2:20.565 default G agony Fluffy_Pillow 202967.7/1100000: 18% mana | 4.0/5: 80% soul_shard soul_harvest, tormented_souls(2), potion_of_prolonged_power
2:21.873 default L unstable_affliction Fluffy_Pillow 186516.2/1100000: 17% mana | 4.0/5: 80% soul_shard soul_harvest, tormented_souls(2), potion_of_prolonged_power
2:23.181 default M unstable_affliction Fluffy_Pillow 203064.7/1100000: 18% mana | 3.0/5: 60% soul_shard soul_harvest, tormented_souls(2), active_uas, potion_of_prolonged_power
2:24.490 default M unstable_affliction Fluffy_Pillow 219645.2/1100000: 20% mana | 3.0/5: 60% soul_shard soul_harvest, tormented_souls(2), active_uas(2), accelerando, potion_of_prolonged_power
2:25.775 default N reap_souls Fluffy_Pillow 236185.4/1100000: 21% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls(2), active_uas(3), accelerando, potion_of_prolonged_power
2:25.775 default Q drain_soul Fluffy_Pillow 236185.4/1100000: 21% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
2:30.315 default Q drain_soul Fluffy_Pillow 130165.0/1100000: 12% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas(2), accelerando(2), potion_of_prolonged_power
2:32.275 default H life_tap Fluffy_Pillow 89824.3/1100000: 8% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, accelerando(2), potion_of_prolonged_power
2:33.539 default I corruption Fluffy_Pillow 436589.4/1100000: 40% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, accelerando(3), potion_of_prolonged_power
2:34.783 default Q drain_soul Fluffy_Pillow 420148.5/1100000: 38% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, accelerando(3), potion_of_prolonged_power
2:36.744 default G agony Fluffy_Pillow 380026.2/1100000: 35% mana | 4.0/5: 80% soul_shard tormented_souls(2), compounding_horror(2), potion_of_prolonged_power
2:38.054 default L unstable_affliction Fluffy_Pillow 363600.0/1100000: 33% mana | 4.0/5: 80% soul_shard tormented_souls(2), compounding_horror(2), potion_of_prolonged_power
2:39.363 default M unstable_affliction Fluffy_Pillow 380161.2/1100000: 35% mana | 3.0/5: 60% soul_shard tormented_souls(2), active_uas, potion_of_prolonged_power
2:40.672 default M unstable_affliction Fluffy_Pillow 396722.3/1100000: 36% mana | 2.0/5: 40% soul_shard tormented_souls(2), active_uas(2), potion_of_prolonged_power
2:41.981 default N reap_souls Fluffy_Pillow 413478.2/1100000: 38% mana | 2.0/5: 40% soul_shard tormented_souls(2), active_uas(3), accelerando, potion_of_prolonged_power
2:41.981 default Q drain_soul Fluffy_Pillow 413478.2/1100000: 38% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
2:46.481 default J corruption Fluffy_Pillow 306401.1/1100000: 28% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), active_uas(2), accelerando, potion_of_prolonged_power
2:47.765 default Q drain_soul Fluffy_Pillow 289928.4/1100000: 26% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), active_uas, accelerando, potion_of_prolonged_power
2:49.723 default Q drain_soul Fluffy_Pillow 249131.4/1100000: 23% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror(2), accelerando, potion_of_prolonged_power
2:55.964 default G agony Fluffy_Pillow 98846.9/1100000: 9% mana | 3.0/5: 60% soul_shard tormented_souls(3), compounding_horror(4), accelerando(2), potion_of_prolonged_power
2:57.228 default H life_tap Fluffy_Pillow 82394.6/1100000: 7% mana | 4.0/5: 80% soul_shard tormented_souls(3), compounding_horror(4), accelerando(2), potion_of_prolonged_power
2:58.493 default L unstable_affliction Fluffy_Pillow 429158.7/1100000: 39% mana | 4.0/5: 80% soul_shard tormented_souls(3), compounding_horror(4), nefarious_pact, accelerando(3), potion_of_prolonged_power
2:59.344 default O reap_souls Fluffy_Pillow 440486.5/1100000: 40% mana | 3.0/5: 60% soul_shard tormented_souls(3), active_uas, nefarious_pact, accelerando(3), potion_of_prolonged_power
2:59.344 default Q drain_soul Fluffy_Pillow 440486.5/1100000: 40% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas, nefarious_pact, accelerando(3), potion_of_prolonged_power
3:00.733 default J corruption Fluffy_Pillow 392975.7/1100000: 36% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas, nefarious_pact, accelerando(3), potion_of_prolonged_power
3:01.585 default Q drain_soul Fluffy_Pillow 371316.9/1100000: 34% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror, active_uas, nefarious_pact, accelerando(3), potion_of_prolonged_power
3:02.921 default M unstable_affliction Fluffy_Pillow 323100.6/1100000: 29% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas, nefarious_pact, accelerando(3), potion_of_prolonged_power
3:03.769 default M unstable_affliction Fluffy_Pillow 334390.7/1100000: 30% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, active_uas(2), nefarious_pact, accelerando(4), potion_of_prolonged_power
3:04.607 default M unstable_affliction Fluffy_Pillow 345729.5/1100000: 31% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, active_uas(2), nefarious_pact, accelerando(4), potion_of_prolonged_power
3:05.444 default Q drain_soul Fluffy_Pillow 356786.8/1100000: 32% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, active_uas(3), nefarious_pact, potion_of_prolonged_power
3:11.088 default Q drain_soul Fluffy_Pillow 132174.9/1100000: 12% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(4), devils_due, accelerando
3:13.495 default G agony Fluffy_Pillow 97157.3/1100000: 9% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(4), devils_due, accelerando
3:15.021 default H life_tap Fluffy_Pillow 83799.6/1100000: 8% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror(5), devils_due, accelerando
3:16.547 default I corruption Fluffy_Pillow 433441.9/1100000: 39% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror(5), devils_due, accelerando
3:18.073 default M unstable_affliction Fluffy_Pillow 420462.9/1100000: 38% mana | 3.0/5: 60% soul_shard tormented_souls, compounding_horror(5), accelerando(3)
3:19.318 default M unstable_affliction Fluffy_Pillow 436579.0/1100000: 40% mana | 2.0/5: 40% soul_shard tormented_souls, active_uas
3:20.625 default M unstable_affliction Fluffy_Pillow 453114.9/1100000: 41% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas(2)
3:21.934 default N reap_souls Fluffy_Pillow 469676.0/1100000: 43% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas(3)
3:21.934 default Q drain_soul Fluffy_Pillow 469676.0/1100000: 43% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(3)
3:28.241 default J corruption Fluffy_Pillow 320476.2/1100000: 29% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror, active_uas, accelerando(3)
3:29.484 default Q drain_soul Fluffy_Pillow 304022.0/1100000: 28% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror, accelerando(3)
3:31.411 default G agony Fluffy_Pillow 264097.1/1100000: 24% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror(2), accelerando(5)
3:32.615 default M unstable_affliction Fluffy_Pillow 247652.8/1100000: 23% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror(2), accelerando(5)
3:33.820 default M unstable_affliction Fluffy_Pillow 264222.2/1100000: 24% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas, accelerando(5)
3:35.023 default M unstable_affliction Fluffy_Pillow 279902.7/1100000: 25% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas(2)
3:36.331 default N reap_souls Fluffy_Pillow 296653.2/1100000: 27% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas(3), nefarious_pact, accelerando
3:36.331 default Q drain_soul Fluffy_Pillow 296653.2/1100000: 27% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), nefarious_pact, accelerando
3:41.221 default H life_tap Fluffy_Pillow 96932.6/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, nefarious_pact, accelerando(3)
3:42.072 default I corruption Fluffy_Pillow 438260.4/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, nefarious_pact, accelerando(3)
3:42.921 default M unstable_affliction Fluffy_Pillow 416561.6/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, nefarious_pact, accelerando(3)
3:43.770 default M unstable_affliction Fluffy_Pillow 427985.1/1100000: 39% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), active_uas, nefarious_pact, accelerando(4)
3:44.605 default M unstable_affliction Fluffy_Pillow 439283.4/1100000: 40% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), nefarious_pact, accelerando(4)
3:45.441 default Q drain_soul Fluffy_Pillow 450595.2/1100000: 41% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), active_uas(3), nefarious_pact, accelerando(4)
3:46.910 default N reap_souls Fluffy_Pillow 404551.8/1100000: 37% mana | 2.0/5: 40% soul_shard tormented_souls(3), active_uas(2), nefarious_pact, accelerando(5)
3:46.910 default Q drain_soul Fluffy_Pillow 404551.8/1100000: 37% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(2), nefarious_pact, accelerando(5)
3:49.465 default G agony Fluffy_Pillow 305429.8/1100000: 28% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror(2), devils_due
3:51.017 default M unstable_affliction Fluffy_Pillow 292065.3/1100000: 27% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror(2), devils_due
3:52.568 default Q drain_soul Fluffy_Pillow 311688.2/1100000: 28% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, active_uas, devils_due
3:55.807 default J corruption Fluffy_Pillow 253667.2/1100000: 23% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas, devils_due
3:57.361 default Q drain_soul Fluffy_Pillow 240328.1/1100000: 22% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas
3:59.311 default M unstable_affliction Fluffy_Pillow 199622.0/1100000: 18% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas, accelerando(2)
4:00.576 default M unstable_affliction Fluffy_Pillow 216197.2/1100000: 20% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, active_uas(2), accelerando(3)
4:01.818 default Q drain_soul Fluffy_Pillow 232729.7/1100000: 21% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, active_uas(2), accelerando(3)
4:03.658 default N reap_souls Fluffy_Pillow 191222.3/1100000: 17% mana | 2.0/5: 40% soul_shard tormented_souls, active_uas(2), accelerando(3)
4:03.658 default Q drain_soul Fluffy_Pillow 191222.3/1100000: 17% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(2), accelerando(3)
4:07.215 default H life_tap Fluffy_Pillow 107632.2/1100000: 10% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror, active_uas, accelerando(5)
4:08.418 default Q drain_soul Fluffy_Pillow 454174.1/1100000: 41% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror, active_uas, accelerando(5)
4:10.260 default C agony Fluffy_Pillow 412514.9/1100000: 38% mana | 2.0/5: 40% soul_shard compounding_horror
4:11.569 default I corruption Fluffy_Pillow 396076.0/1100000: 36% mana | 3.0/5: 60% soul_shard compounding_horror
4:12.877 default M unstable_affliction Fluffy_Pillow 379895.1/1100000: 35% mana | 3.0/5: 60% soul_shard compounding_horror, accelerando
4:14.162 default M unstable_affliction Fluffy_Pillow 396435.3/1100000: 36% mana | 2.0/5: 40% soul_shard active_uas, accelerando
4:15.447 default M unstable_affliction Fluffy_Pillow 412975.5/1100000: 38% mana | 1.0/5: 20% soul_shard active_uas(2), accelerando
4:16.733 default D soul_harvest Fluffy_Pillow 429528.6/1100000: 39% mana | 0.0/5: 0% soul_shard active_uas(3), accelerando
4:16.733 default Q drain_soul Fluffy_Pillow 429528.6/1100000: 39% mana | 0.0/5: 0% soul_shard soul_harvest, active_uas(3), accelerando
4:18.639 default N reap_souls Fluffy_Pillow 388062.2/1100000: 35% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls, active_uas(3), accelerando
4:18.639 default Q drain_soul Fluffy_Pillow 388062.2/1100000: 35% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(3), accelerando
4:24.818 default G agony Fluffy_Pillow 236339.2/1100000: 21% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, compounding_horror(2)
4:26.127 default I corruption Fluffy_Pillow 219900.3/1100000: 20% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, compounding_horror(2)
4:27.437 default M unstable_affliction Fluffy_Pillow 203557.7/1100000: 19% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, compounding_horror(2), accelerando
4:28.723 default M unstable_affliction Fluffy_Pillow 220110.8/1100000: 20% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls, active_uas, accelerando
4:30.007 default M unstable_affliction Fluffy_Pillow 236638.2/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, active_uas, accelerando
4:31.293 default K unstable_affliction Fluffy_Pillow 253191.2/1100000: 23% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, active_uas(2), accelerando
4:32.578 default N reap_souls Fluffy_Pillow 269731.5/1100000: 25% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls, active_uas(3), accelerando
4:32.578 default Q drain_soul Fluffy_Pillow 269731.5/1100000: 25% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(3), accelerando
4:36.279 default K unstable_affliction Fluffy_Pillow 185873.2/1100000: 17% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, active_uas(2), accelerando(3)
4:37.522 default Q drain_soul Fluffy_Pillow 202419.0/1100000: 18% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(3)
4:39.352 default F corruption Fluffy_Pillow 160604.5/1100000: 15% mana | 0.0/5: 0% soul_shard active_uas
4:40.658 default Q drain_soul Fluffy_Pillow 144127.7/1100000: 13% mana | 0.0/5: 0% soul_shard
4:42.585 default H life_tap Fluffy_Pillow 102507.7/1100000: 9% mana | 0.0/5: 0% soul_shard
4:43.894 default G agony Fluffy_Pillow 449068.8/1100000: 41% mana | 1.0/5: 20% soul_shard
4:45.204 default K unstable_affliction Fluffy_Pillow 432642.6/1100000: 39% mana | 1.0/5: 20% soul_shard
4:46.512 default Q drain_soul Fluffy_Pillow 449244.8/1100000: 41% mana | 0.0/5: 0% soul_shard active_uas, accelerando
4:51.068 default B reap_souls Fluffy_Pillow 342888.6/1100000: 31% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas, accelerando
4:51.068 default Q drain_soul Fluffy_Pillow 342888.6/1100000: 31% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando
4:53.061 default F corruption Fluffy_Pillow 302542.0/1100000: 28% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas, accelerando
4:54.347 default Q drain_soul Fluffy_Pillow 286095.1/1100000: 26% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, accelerando
4:58.921 default K unstable_affliction Fluffy_Pillow 180613.6/1100000: 16% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 56337 56337 35395
Intellect 51117 49411 39731 (1278)
Spirit 0 0 0
Health 3380220 3380220 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 51117 49411 0
Crit 20.98% 20.98% 6393
Haste 15.02% 15.02% 5631
Damage / Heal Versatility 2.33% 2.33% 1107
ManaReg per Second 12652 12652 0
Mastery 122.97% 119.97% 12155
Armor 2008 2008 2008
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 909.00
Local Head Eyes of Azj'Aqir
ilevel: 905, stats: { 257 Armor, +3410 Sta, +2273 Int, +1094 Haste, +589 Vers }
Local Neck Beleron's Choker of Misery
ilevel: 905, stats: { +1918 Sta, +1727 Crit, +1295 Mastery }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Master Warmage's Leggings
ilevel: 905, stats: { 277 Armor, +3410 Sta, +2273 Int, +914 Mastery, +769 Haste }
Local Feet Norgannon's Foresight
ilevel: 940, stats: { 247 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Mastery, +617 Crit }
Local Wrists Bracers of Harnessed Flame
ilevel: 905, stats: { 139 Armor, +1918 Sta, +1278 Int, +595 Mastery, +351 Crit }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Spellblade's Gemmed Signet
ilevel: 905, stats: { +1918 Sta, +2073 Crit, +950 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Temporal Recalibration
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +636 Mastery, +311 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Norgannons_Foresight"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3518
neck=belerons_choker_of_misery,id=140899,bonus_id=3518,enchant=mark_of_the_trained_soldier
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518
back=cloak_of_temporal_recalibration,id=140910,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3518
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518
legs=master_warmages_leggings,id=140852,bonus_id=3518
feet=norgannons_foresight,id=132455,ilevel=940
finger1=spellblades_gemmed_signet,id=140895,bonus_id=3518,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=erratic_metronome,id=140792,bonus_id=3445
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=909.27
# gear_stamina=35395
# gear_intellect=39731
# gear_crit_rating=6268
# gear_haste_rating=5521
# gear_mastery_rating=11917
# gear_versatility_rating=1085
# gear_armor=2008
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Pillars_of_the_Dark_Portal : 931927 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
931926.7 931926.7 1446.9 / 0.155% 206838.8 / 22.2% 30.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
28148.6 28148.6 Mana 0.00% 32.3 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Pillars_of_the_Dark_Portal 931927
Agony 135150 14.5% 17.3 18.09sec 2344739 1896031 Periodic 188.7 141621 374310 214745 31.4% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.28 0.00 188.68 188.68 1.2367 1.5857 40516281.97 40516281.97 0.00 126398.50 1896030.79
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.4 68.57% 141621.15 13381 237101 141666.50 122385 160786 18323469 18323469 0.00
crit 59.3 31.43% 374310.39 31043 625946 374276.50 304420 436838 22192813 22192813 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 6451 0.7% 25.0 11.80sec 77330 0 Direct 25.0 62213 124094 77331 24.4%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.00 25.00 0.00 0.00 0.0000 0.0000 1933053.79 1933053.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.89 75.57% 62212.83 20036 192895 62439.81 33288 99621 1175205 1175205 0.00
crit 6.11 24.43% 124094.39 40072 385790 124555.51 0 272451 757849 757849 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 118153 12.7% 21.9 13.85sec 1614091 1335413 Periodic 188.2 124124 327630 188155 31.5% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 0.00 188.21 188.21 1.2087 1.5823 35412482.01 35412482.01 0.00 109186.24 1335413.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.0 68.54% 124123.86 58 203561 124183.64 109866 138058 16010920 16010920 0.00
crit 59.2 31.46% 327629.76 3526 537401 327666.24 266161 385521 19401562 19401562 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 118546 12.7% 64.0 4.64sec 555572 194247 Periodic 216.7 123959 250360 163986 31.7% 56.9%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.96 0.00 216.69 216.69 2.8601 0.7874 35533491.71 35533491.71 0.00 194247.45 194247.45
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.1 68.33% 123958.54 79645 162034 124029.49 111426 133640 18353940 18353940 0.00
crit 68.6 31.67% 250359.53 159291 324069 250449.00 225822 271198 17179551 17179551 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 24659 2.6% 49.4 5.94sec 149525 0 Direct 49.2 120720 241244 150235 24.5%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.43 49.20 0.00 0.00 0.0000 0.0000 7391047.17 7391047.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.15 75.51% 120720.02 81398 156729 120712.79 108150 131998 4484366 4484366 0.00
crit 12.05 24.49% 241244.47 162797 313459 241225.83 191955 288444 2906682 2906682 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Soul 18749 2.0% 15.8 17.63sec 355544 0 Direct 15.8 285988 572905 355549 24.2%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.81 15.81 0.00 0.00 0.0000 0.0000 5620360.71 5620360.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.97 75.75% 285987.50 187840 361678 285721.72 228459 361678 3424641 3424641 0.00
crit 3.83 24.25% 572905.29 375680 723356 559506.89 0 723356 2195720 2195720 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (429637) 0.0% (46.1%) 46.7 6.39sec 2754560 2312121

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.72 0.00 0.00 0.00 1.1914 0.0000 0.00 0.00 0.00 2312120.99 2312120.99
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 190921 20.5% 0.0 0.00sec 0 0 Periodic 107.8 309511 826288 530812 42.8% 50.8%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 107.83 107.83 0.0000 1.4136 57236280.10 57236280.10 0.00 375477.45 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.7 57.18% 309511.33 332 480547 309967.34 250571 368504 19083678 19083678 0.00
crit 46.2 42.82% 826288.11 487 1268644 827243.53 654933 1009696 38152602 38152602 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 149113 16.0% 0.0 0.00sec 0 0 Periodic 79.1 328373 872343 564454 43.4% 36.8%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 79.14 79.14 0.0000 1.3955 44672443.17 44672443.17 0.00 404473.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.8 56.60% 328372.84 330 480547 329188.49 268218 389247 14709229 14709229 0.00
crit 34.3 43.40% 872343.38 667 1268644 874337.87 660984 1148256 29963214 29963214 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 83240 8.9% 0.0 0.00sec 0 0 Periodic 42.9 337420 895993 580805 43.6% 19.4%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 42.85 42.85 0.0000 1.3604 24887436.02 24887436.02 0.00 426936.96 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.2 56.43% 337419.61 750 480547 340757.78 228800 480547 8159121 8159121 0.00
crit 18.7 43.57% 895992.63 667 1268644 904654.73 44210 1268644 16728315 16728315 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 5481 0.6% 0.0 0.00sec 0 0 Periodic 3.0 309474 830459 534821 43.3% 1.4%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 3.04 3.04 0.0000 1.3994 1627813.99 1627813.99 0.00 382205.68 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.7 56.75% 309474.43 1848 480547 141438.55 0 480547 534646 534646 0.00
crit 1.3 43.25% 830458.67 2524 1268644 366735.11 0 1268644 1093168 1093168 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 883 0.1% 0.0 0.00sec 0 0 Periodic 0.5 298051 788862 507746 42.7% 0.2%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.52 0.52 0.0000 1.4370 261744.48 261744.48 0.00 353708.75 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 57.28% 298051.06 2076 480547 29097.52 0 480547 88002 88002 0.00
crit 0.2 42.72% 788862.19 6892 1268644 72369.57 0 1268644 173742 173742 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 80581 / 80581
Doom Bolt 80581 8.7% 121.3 2.46sec 199211 82937 Direct 120.5 161121 322136 200491 24.5%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.28 120.51 0.00 0.00 2.4020 0.0000 24161153.79 24161153.79 0.00 82936.53 82936.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.04 75.55% 161120.79 133738 231327 161161.12 152105 168061 14668306 14668306 0.00
crit 29.47 24.45% 322136.34 267476 462655 322219.18 297802 357655 9492847 9492847 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Pillars_of_the_Dark_Portal
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Pillars_of_the_Dark_Portal
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Pillars_of_the_Dark_Portal
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Pillars_of_the_Dark_Portal
  • harmful:false
  • if_expr:
 
Life Tap 11.1 23.26sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.10 0.00 0.00 0.00 1.2290 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 12.5 24.92sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.3 154.84sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.29 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.9 0.0 15.4sec 15.4sec 78.08% 78.08% 2.1(2.1) 19.1

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.00%
  • accelerando_2:23.70%
  • accelerando_3:14.55%
  • accelerando_4:6.98%
  • accelerando_5:3.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 22.3 24.3 13.6sec 0.0sec 56.05% 56.05% 0.0(0.0) 0.0

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:29.30%
  • active_uas_2:17.29%
  • active_uas_3:9.23%
  • active_uas_4:0.19%
  • active_uas_5:0.04%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 27.2 38.8 11.0sec 4.5sec 61.39% 100.00% 2.2(2.2) 1.6

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:25.74%
  • compounding_horror_2:16.81%
  • compounding_horror_3:9.83%
  • compounding_horror_4:5.15%
  • compounding_horror_5:3.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 12.5 0.0 24.7sec 24.7sec 74.13% 74.13% 0.0(0.0) 11.5

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:74.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.9sec 68.9sec 8.78% 8.78% 0.0(0.0) 3.2

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.78%

Trigger Attempt Success

  • trigger_pct:99.86%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.5 0.0 69.3sec 68.4sec 13.63% 13.63% 0.0(0.0) 3.3

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.63%

Trigger Attempt Success

  • trigger_pct:99.86%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 164.9sec 0.0sec 38.47% 38.47% 0.0(0.0) 1.9

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:38.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.3 0.0 154.7sec 154.7sec 12.87% 12.87% 0.0(0.0) 2.2

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:12.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 13.2 34.4 23.6sec 6.7sec 76.32% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:23.04%
  • tormented_souls_2:18.54%
  • tormented_souls_3:13.75%
  • tormented_souls_4:9.47%
  • tormented_souls_5:5.65%
  • tormented_souls_6:3.12%
  • tormented_souls_7:1.73%
  • tormented_souls_8:0.58%
  • tormented_souls_9:0.24%
  • tormented_souls_10:0.12%
  • tormented_souls_11:0.05%
  • tormented_souls_12:0.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 5.9 41.8sec
t18_2pc_affliction 46.7 6.4sec
soul_conduit 9.3 28.8sec
souls_consumed 45.9 24.7sec

Resources

Resource Usage Type Count Total Average RPE APR
Pillars_of_the_Dark_Portal
agony Mana 17.3 570221.3 33000.0 32999.6 71.1
corruption Mana 21.9 724008.0 33000.0 33000.1 48.9
drain_soul Mana 216.7 7150604.6 33000.0 111800.9 5.0
unstable_affliction Soul Shard 46.7 46.7 1.0 1.0 2754499.4
pet - doomguard
doom_bolt Energy 121.3 4245.0 35.0 35.0 5691.7
Resource Gains Type Count Total Average Overflow
life_tap Mana 11.10 3663178.09 (48.09%) 330000.00 0.00 0.00%
agony Soul Shard 34.69 34.69 (77.81%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.58 0.58 (1.30%) 1.00 0.00 0.00%
mp5_regen Mana 346.10 3953742.11 (51.91%) 11423.66 21588.07 0.54%
soul_conduit Soul Shard 9.31 9.31 (20.89%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 195.57 4203.50 (100.00%) 21.49 117.21 2.71%
Resource RPS-Gain RPS-Loss
Health 0.00 12859.17
Mana 25388.73 28148.60
Soul Shard 0.15 0.16
Combat End Resource Mean Min Max
Mana 274100.18 43199.93 506209.21
Soul Shard 0.84 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Pillars_of_the_Dark_Portal Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Pillars_of_the_Dark_Portal Damage Per Second
Count 4999
Mean 931926.73
Minimum 745393.47
Maximum 1156121.78
Spread ( max - min ) 410728.32
Range [ ( max - min ) / 2 * 100% ] 22.04%
Standard Deviation 52197.1287
5th Percentile 847818.36
95th Percentile 1021565.13
( 95th Percentile - 5th Percentile ) 173746.77
Mean Distribution
Standard Deviation 738.2527
95.00% Confidence Intervall ( 930479.78 - 933373.68 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 121
0.1% Error 12052
0.1 Scale Factor Error with Delta=300 23258243
0.05 Scale Factor Error with Delta=300 93032971
0.01 Scale Factor Error with Delta=300 2325824257
Priority Target DPS
Sample Data Pillars_of_the_Dark_Portal Priority Target Damage Per Second
Count 4999
Mean 931926.73
Minimum 745393.47
Maximum 1156121.78
Spread ( max - min ) 410728.32
Range [ ( max - min ) / 2 * 100% ] 22.04%
Standard Deviation 52197.1287
5th Percentile 847818.36
95th Percentile 1021565.13
( 95th Percentile - 5th Percentile ) 173746.77
Mean Distribution
Standard Deviation 738.2527
95.00% Confidence Intervall ( 930479.78 - 933373.68 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 121
0.1% Error 12052
0.1 Scale Factor Error with Delta=300 23258243
0.05 Scale Factor Error with Delta=300 93032971
0.01 Scale Factor Error with Delta=300 2325824257
DPS(e)
Sample Data Pillars_of_the_Dark_Portal Damage Per Second (Effective)
Count 4999
Mean 931926.73
Minimum 745393.47
Maximum 1156121.78
Spread ( max - min ) 410728.32
Range [ ( max - min ) / 2 * 100% ] 22.04%
Damage
Sample Data Pillars_of_the_Dark_Portal Damage
Count 4999
Mean 255092435.12
Minimum 170420902.32
Maximum 346263902.62
Spread ( max - min ) 175843000.30
Range [ ( max - min ) / 2 * 100% ] 34.47%
DTPS
Sample Data Pillars_of_the_Dark_Portal Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Pillars_of_the_Dark_Portal Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Pillars_of_the_Dark_Portal Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pillars_of_the_Dark_Portal Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pillars_of_the_Dark_Portal Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pillars_of_the_Dark_Portal Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Pillars_of_the_Dark_PortalTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Pillars_of_the_Dark_Portal Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 1.45 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 4.56 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
D 2.29 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
E 0.96 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 0.87 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
G 12.72 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
H 10.49 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
I 14.35 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
J 6.72 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
K 5.70 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
L 1.59 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
M 39.60 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
N 8.74 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
O 2.28 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
P 0.61 life_tap,if=mana.pct<=10
Q 48.60 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACIMMMDNQIQGMMMQIQMQCQQHILOQCQILMMQHQGIMMMNQQHIGMMMQJQGHQIMMMNQGIMMMDEQQQHIGMQMNQJQGHMQIQMOQCIHMMMNQGIMMQNQQHQIQGMMMNQJNQMMQHNQGQIMMQQHQGQIMMMDNQIGHMMNQKQIQHGKKNQJQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Pillars_of_the_Dark_Portal 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Pillars_of_the_Dark_Portal 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Pillars_of_the_Dark_Portal 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.338 default I corruption Fluffy_Pillow 1088903.4/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:02.349 default M unstable_affliction Fluffy_Pillow 1072453.7/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:03.360 default M unstable_affliction Fluffy_Pillow 1089004.1/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, accelerando, potion_of_prolonged_power
0:04.372 default M unstable_affliction Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), accelerando(2), potion_of_prolonged_power
0:05.366 default D soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(3), accelerando(2), potion_of_prolonged_power
0:05.366 default N reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, active_uas(3), accelerando(2), potion_of_prolonged_power
0:05.366 default Q drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), accelerando(2), potion_of_prolonged_power
0:11.532 default I corruption Fluffy_Pillow 905700.1/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:12.526 default Q drain_soul Fluffy_Pillow 888996.2/1100000: 81% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, compounding_horror(2), accelerando, potion_of_prolonged_power
0:14.128 default G agony Fluffy_Pillow 849221.3/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, compounding_horror(2), accelerando, potion_of_prolonged_power
0:15.139 default M unstable_affliction Fluffy_Pillow 832771.7/1100000: 76% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, compounding_horror(2), accelerando, potion_of_prolonged_power
0:16.151 default M unstable_affliction Fluffy_Pillow 849338.4/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas, nefarious_pact, accelerando, potion_of_prolonged_power
0:16.906 default M unstable_affliction Fluffy_Pillow 861697.9/1100000: 78% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas(2), nefarious_pact, accelerando, potion_of_prolonged_power
0:17.660 default Q drain_soul Fluffy_Pillow 874059.9/1100000: 79% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas(3), nefarious_pact, accelerando(2), potion_of_prolonged_power
0:25.401 default I corruption Fluffy_Pillow 445442.5/1100000: 40% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls(3), compounding_horror(5), nefarious_pact, potion_of_prolonged_power
0:26.154 default Q drain_soul Fluffy_Pillow 424554.2/1100000: 39% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls(3), compounding_horror(5), nefarious_pact, potion_of_prolonged_power
0:27.351 default M unstable_affliction Fluffy_Pillow 377807.5/1100000: 34% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls(3), compounding_horror(5), nefarious_pact, potion_of_prolonged_power
0:28.105 default Q drain_soul Fluffy_Pillow 389972.5/1100000: 35% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls(3), active_uas, devils_due, accelerando, potion_of_prolonged_power
0:33.828 default C agony Fluffy_Pillow 254828.5/1100000: 23% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, tormented_souls(4), active_uas, devils_due, accelerando(3), potion_of_prolonged_power
0:34.987 default Q drain_soul Fluffy_Pillow 241463.7/1100000: 22% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, tormented_souls(4), compounding_horror, devils_due, accelerando(3), potion_of_prolonged_power
0:39.127 default Q drain_soul Fluffy_Pillow 146601.5/1100000: 13% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls(4), compounding_horror(2), accelerando(3), potion_of_prolonged_power
0:40.736 default H life_tap Fluffy_Pillow 107265.1/1100000: 10% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls(5), compounding_horror(2), potion_of_prolonged_power
0:41.766 default I corruption Fluffy_Pillow 450009.1/1100000: 41% mana | 3.0/5: 60% soul_shard tormented_souls(5), compounding_horror(2), potion_of_prolonged_power
0:43.104 default L unstable_affliction Fluffy_Pillow 433563.9/1100000: 39% mana | 4.0/5: 80% soul_shard tormented_souls(5), compounding_horror(2), potion_of_prolonged_power
0:44.443 default O reap_souls Fluffy_Pillow 450131.1/1100000: 41% mana | 3.0/5: 60% soul_shard tormented_souls(5), active_uas, potion_of_prolonged_power
0:44.443 default Q drain_soul Fluffy_Pillow 450131.1/1100000: 41% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas, potion_of_prolonged_power
0:51.817 default C agony Fluffy_Pillow 278461.1/1100000: 25% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(2), potion_of_prolonged_power
0:53.108 default Q drain_soul Fluffy_Pillow 262001.7/1100000: 24% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(2), potion_of_prolonged_power
0:55.135 default I corruption Fluffy_Pillow 222040.4/1100000: 20% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(3), potion_of_prolonged_power
0:56.405 default L unstable_affliction Fluffy_Pillow 205590.9/1100000: 19% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(3), potion_of_prolonged_power
0:57.678 default M unstable_affliction Fluffy_Pillow 222180.6/1100000: 20% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(3), potion_of_prolonged_power
0:58.948 default M unstable_affliction Fluffy_Pillow 238731.1/1100000: 22% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), accelerando(3)
1:00.219 default Q drain_soul Fluffy_Pillow 255483.6/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas(3), nefarious_pact, accelerando(4)
1:04.524 default H life_tap Fluffy_Pillow 78336.4/1100000: 7% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(6), active_uas(2), nefarious_pact
1:05.440 default Q drain_soul Fluffy_Pillow 419669.9/1100000: 38% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(6), active_uas, nefarious_pact
1:06.873 default G agony Fluffy_Pillow 371448.3/1100000: 34% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(7), compounding_horror, nefarious_pact, accelerando
1:07.773 default I corruption Fluffy_Pillow 349781.5/1100000: 32% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(7), compounding_horror, nefarious_pact, accelerando
1:08.669 default M unstable_affliction Fluffy_Pillow 328064.4/1100000: 30% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(7), compounding_horror, nefarious_pact, accelerando
1:09.568 default M unstable_affliction Fluffy_Pillow 339385.1/1100000: 31% mana | 1.0/5: 20% soul_shard tormented_souls(7), active_uas, nefarious_pact, accelerando
1:10.465 default M unstable_affliction Fluffy_Pillow 350680.6/1100000: 32% mana | 1.0/5: 20% soul_shard tormented_souls(7), active_uas(2), nefarious_pact, accelerando
1:11.364 default N reap_souls Fluffy_Pillow 362063.4/1100000: 33% mana | 1.0/5: 20% soul_shard tormented_souls(7), active_uas(3), nefarious_pact, accelerando(3)
1:11.364 default Q drain_soul Fluffy_Pillow 362063.4/1100000: 33% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(3), nefarious_pact, accelerando(3)
1:19.969 default Q drain_soul Fluffy_Pillow 111814.5/1100000: 10% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), devils_due
1:22.525 default H life_tap Fluffy_Pillow 77558.0/1100000: 7% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), accelerando
1:23.839 default I corruption Fluffy_Pillow 424104.6/1100000: 39% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), accelerando
1:25.154 default G agony Fluffy_Pillow 407663.7/1100000: 37% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), accelerando
1:26.470 default M unstable_affliction Fluffy_Pillow 391235.5/1100000: 36% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), accelerando
1:27.782 default M unstable_affliction Fluffy_Pillow 407756.8/1100000: 37% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando
1:29.095 default M unstable_affliction Fluffy_Pillow 424291.5/1100000: 39% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), accelerando(2)
1:30.388 default Q drain_soul Fluffy_Pillow 440857.7/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas(3), accelerando(2)
1:36.667 default J corruption Fluffy_Pillow 289282.4/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, active_uas, accelerando
1:37.983 default Q drain_soul Fluffy_Pillow 272854.1/1100000: 25% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, accelerando
1:44.322 default G agony Fluffy_Pillow 121678.0/1100000: 11% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(2), accelerando
1:45.636 default H life_tap Fluffy_Pillow 105224.6/1100000: 10% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(3), accelerando
1:46.950 default Q drain_soul Fluffy_Pillow 451833.1/1100000: 41% mana | 2.0/5: 40% soul_shard tormented_souls(5), compounding_horror(3), accelerando(2)
1:49.809 default I corruption Fluffy_Pillow 388713.3/1100000: 35% mana | 3.0/5: 60% soul_shard tormented_souls(5), compounding_horror(3), accelerando
1:51.124 default M unstable_affliction Fluffy_Pillow 372483.4/1100000: 34% mana | 3.0/5: 60% soul_shard tormented_souls(5), compounding_horror(3), accelerando(2)
1:52.415 default M unstable_affliction Fluffy_Pillow 389024.8/1100000: 35% mana | 2.0/5: 40% soul_shard tormented_souls(6), active_uas, accelerando(3)
1:53.685 default M unstable_affliction Fluffy_Pillow 405588.1/1100000: 37% mana | 1.0/5: 20% soul_shard tormented_souls(6), active_uas(2), accelerando(4)
1:54.934 default N reap_souls Fluffy_Pillow 422139.4/1100000: 38% mana | 0.0/5: 0% soul_shard tormented_souls(6), active_uas(3), accelerando(4)
1:54.934 default Q drain_soul Fluffy_Pillow 422139.4/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), accelerando(4)
2:01.908 default G agony Fluffy_Pillow 250293.0/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando
2:03.224 default I corruption Fluffy_Pillow 233864.8/1100000: 21% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(4), accelerando
2:04.537 default M unstable_affliction Fluffy_Pillow 217687.2/1100000: 20% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(4), accelerando(2)
2:05.829 default M unstable_affliction Fluffy_Pillow 234240.6/1100000: 21% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(2)
2:07.119 default M unstable_affliction Fluffy_Pillow 250768.3/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), accelerando(2)
2:08.411 default D soul_harvest Fluffy_Pillow 267321.7/1100000: 24% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(3), accelerando(2)
2:08.411 default E potion Fluffy_Pillow 267321.7/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), active_uas(3), accelerando(2)
2:08.411 default Q drain_soul Fluffy_Pillow 267321.7/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), active_uas(3), accelerando(2), potion_of_prolonged_power
2:12.916 default Q drain_soul Fluffy_Pillow 160040.7/1100000: 15% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(4), compounding_horror, active_uas(2), accelerando(2), potion_of_prolonged_power
2:14.858 default Q drain_soul Fluffy_Pillow 118359.0/1100000: 11% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(4), compounding_horror, active_uas, potion_of_prolonged_power
2:16.843 default H life_tap Fluffy_Pillow 76919.0/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(4), compounding_horror(3), potion_of_prolonged_power
2:18.181 default I corruption Fluffy_Pillow 423473.8/1100000: 38% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(4), compounding_horror(3), potion_of_prolonged_power
2:19.518 default G agony Fluffy_Pillow 407061.7/1100000: 37% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(4), compounding_horror(3), accelerando, potion_of_prolonged_power
2:20.832 default M unstable_affliction Fluffy_Pillow 390608.2/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(4), compounding_horror(3), accelerando, potion_of_prolonged_power
2:22.146 default Q drain_soul Fluffy_Pillow 407154.8/1100000: 37% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(4), active_uas, accelerando, potion_of_prolonged_power
2:26.718 default M unstable_affliction Fluffy_Pillow 300197.7/1100000: 27% mana | 1.0/5: 20% soul_shard tormented_souls(4), active_uas, accelerando(2), potion_of_prolonged_power
2:28.009 default N reap_souls Fluffy_Pillow 316738.3/1100000: 29% mana | 0.0/5: 0% soul_shard tormented_souls(4), active_uas(2), accelerando(2), potion_of_prolonged_power
2:28.009 default Q drain_soul Fluffy_Pillow 316738.3/1100000: 29% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(2), potion_of_prolonged_power
2:31.635 default J corruption Fluffy_Pillow 231589.9/1100000: 21% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, potion_of_prolonged_power
2:32.972 default Q drain_soul Fluffy_Pillow 215132.4/1100000: 20% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, potion_of_prolonged_power
2:37.657 default G agony Fluffy_Pillow 108347.0/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(3), accelerando, potion_of_prolonged_power
2:38.972 default H life_tap Fluffy_Pillow 91906.1/1100000: 8% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(3), accelerando, potion_of_prolonged_power
2:40.288 default M unstable_affliction Fluffy_Pillow 438477.9/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(3), accelerando, potion_of_prolonged_power
2:41.602 default Q drain_soul Fluffy_Pillow 455024.4/1100000: 41% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando, potion_of_prolonged_power
2:46.194 default I corruption Fluffy_Pillow 348844.3/1100000: 32% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), accelerando(3), potion_of_prolonged_power
2:47.465 default Q drain_soul Fluffy_Pillow 332407.8/1100000: 30% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, accelerando(3), potion_of_prolonged_power
2:49.338 default M unstable_affliction Fluffy_Pillow 290282.7/1100000: 26% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror, potion_of_prolonged_power
2:50.676 default O reap_souls Fluffy_Pillow 306837.5/1100000: 28% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas, potion_of_prolonged_power
2:50.676 default Q drain_soul Fluffy_Pillow 306837.5/1100000: 28% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, potion_of_prolonged_power
2:58.021 default C agony Fluffy_Pillow 134562.7/1100000: 12% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando, potion_of_prolonged_power
2:59.336 default I corruption Fluffy_Pillow 118121.9/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando, potion_of_prolonged_power
3:00.651 default H life_tap Fluffy_Pillow 101681.0/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando, potion_of_prolonged_power
3:01.966 default M unstable_affliction Fluffy_Pillow 448240.2/1100000: 41% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), accelerando, potion_of_prolonged_power
3:03.281 default M unstable_affliction Fluffy_Pillow 464881.9/1100000: 42% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(2), potion_of_prolonged_power
3:04.572 default M unstable_affliction Fluffy_Pillow 481422.5/1100000: 44% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), accelerando(2), potion_of_prolonged_power
3:05.863 default N reap_souls Fluffy_Pillow 497963.1/1100000: 45% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas(3), accelerando(2), potion_of_prolonged_power
3:05.863 default Q drain_soul Fluffy_Pillow 497963.1/1100000: 45% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), accelerando(2), potion_of_prolonged_power
3:13.063 default G agony Fluffy_Pillow 325781.7/1100000: 30% mana | 1.0/5: 20% soul_shard deadwind_harvester, accelerando(2)
3:14.355 default I corruption Fluffy_Pillow 309335.1/1100000: 28% mana | 1.0/5: 20% soul_shard deadwind_harvester, accelerando(2)
3:15.648 default M unstable_affliction Fluffy_Pillow 293185.3/1100000: 27% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, accelerando(3)
3:16.919 default M unstable_affliction Fluffy_Pillow 309748.9/1100000: 28% mana | 1.0/5: 20% soul_shard active_uas, accelerando(3)
3:18.188 default Q drain_soul Fluffy_Pillow 326286.4/1100000: 30% mana | 0.0/5: 0% soul_shard active_uas(2), nefarious_pact, accelerando(3)
3:21.238 default N reap_souls Fluffy_Pillow 199367.5/1100000: 18% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, active_uas(2), nefarious_pact
3:21.238 default Q drain_soul Fluffy_Pillow 199367.5/1100000: 18% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, active_uas(2), nefarious_pact
3:23.259 default Q drain_soul Fluffy_Pillow 125372.9/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(3), active_uas, nefarious_pact
3:24.666 default H life_tap Fluffy_Pillow 77001.2/1100000: 7% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(3), nefarious_pact, accelerando
3:25.567 default Q drain_soul Fluffy_Pillow 418347.0/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(3), nefarious_pact, accelerando
3:27.535 default I corruption Fluffy_Pillow 344732.0/1100000: 31% mana | 2.0/5: 40% soul_shard compounding_horror(4), nefarious_pact, accelerando(3)
3:28.403 default Q drain_soul Fluffy_Pillow 323043.7/1100000: 29% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror(4), nefarious_pact, accelerando(3)
3:31.008 default G agony Fluffy_Pillow 224991.8/1100000: 20% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror(4), devils_due, accelerando(3)
3:32.513 default M unstable_affliction Fluffy_Pillow 211604.9/1100000: 19% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror(4), devils_due, accelerando(3)
3:34.018 default M unstable_affliction Fluffy_Pillow 231217.9/1100000: 21% mana | 2.0/5: 40% soul_shard tormented_souls, active_uas, devils_due, accelerando(3)
3:35.524 default M unstable_affliction Fluffy_Pillow 250844.0/1100000: 23% mana | 2.0/5: 40% soul_shard tormented_souls, active_uas(2), devils_due, accelerando(3)
3:37.031 default N reap_souls Fluffy_Pillow 269583.4/1100000: 25% mana | 2.0/5: 40% soul_shard tormented_souls, active_uas(3), devils_due
3:37.031 default Q drain_soul Fluffy_Pillow 269583.4/1100000: 25% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(3), devils_due
3:41.535 default J corruption Fluffy_Pillow 193595.4/1100000: 18% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas(3), nefarious_pact, accelerando
3:42.432 default N reap_souls Fluffy_Pillow 172086.4/1100000: 16% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror(3), active_uas(2), nefarious_pact, accelerando(2)
3:42.432 default Q drain_soul Fluffy_Pillow 172086.4/1100000: 16% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(3), active_uas(2), nefarious_pact, accelerando(2)
3:43.773 default M unstable_affliction Fluffy_Pillow 123267.6/1100000: 11% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(3), active_uas, nefarious_pact, accelerando(2)
3:44.657 default M unstable_affliction Fluffy_Pillow 134758.6/1100000: 12% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(2), nefarious_pact, accelerando(3)
3:45.528 default Q drain_soul Fluffy_Pillow 146109.4/1100000: 13% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(2), nefarious_pact, accelerando(3)
3:46.966 default H life_tap Fluffy_Pillow 98849.3/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas(2), nefarious_pact, accelerando(3)
3:47.835 default N reap_souls Fluffy_Pillow 440174.1/1100000: 40% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror, active_uas(2), nefarious_pact, accelerando(3)
3:47.835 default Q drain_soul Fluffy_Pillow 440174.1/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, active_uas(2), nefarious_pact, accelerando(3)
3:50.335 default G agony Fluffy_Pillow 340753.9/1100000: 31% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, devils_due, accelerando(3)
3:51.841 default Q drain_soul Fluffy_Pillow 327379.9/1100000: 30% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror, devils_due, accelerando(3)
3:56.174 default I corruption Fluffy_Pillow 250104.7/1100000: 23% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), devils_due, accelerando(2)
3:57.708 default M unstable_affliction Fluffy_Pillow 236758.7/1100000: 22% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), devils_due, accelerando(2)
3:59.240 default M unstable_affliction Fluffy_Pillow 256387.0/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(2)
4:00.532 default Q drain_soul Fluffy_Pillow 272941.5/1100000: 25% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), nefarious_pact, accelerando(3)
4:03.669 default Q drain_soul Fluffy_Pillow 148822.6/1100000: 14% mana | 1.0/5: 20% soul_shard compounding_horror, active_uas(2), nefarious_pact, accelerando(3)
4:05.166 default H life_tap Fluffy_Pillow 101975.5/1100000: 9% mana | 1.0/5: 20% soul_shard compounding_horror, active_uas, nefarious_pact
4:06.083 default Q drain_soul Fluffy_Pillow 443321.3/1100000: 40% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, active_uas, nefarious_pact
4:07.492 default G agony Fluffy_Pillow 394930.8/1100000: 36% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, nefarious_pact, accelerando
4:08.390 default Q drain_soul Fluffy_Pillow 373238.9/1100000: 34% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), nefarious_pact, accelerando
4:09.806 default I corruption Fluffy_Pillow 325069.9/1100000: 30% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), nefarious_pact, accelerando
4:10.704 default M unstable_affliction Fluffy_Pillow 303377.9/1100000: 28% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror(2), nefarious_pact, accelerando
4:11.604 default M unstable_affliction Fluffy_Pillow 314711.2/1100000: 29% mana | 2.0/5: 40% soul_shard tormented_souls, active_uas, nefarious_pact, accelerando
4:12.503 default M unstable_affliction Fluffy_Pillow 326031.8/1100000: 30% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas(2), nefarious_pact, accelerando
4:13.402 default D soul_harvest Fluffy_Pillow 337352.5/1100000: 31% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas(3), devils_due, accelerando
4:13.402 default N reap_souls Fluffy_Pillow 337352.5/1100000: 31% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls(2), active_uas(3), devils_due, accelerando
4:13.402 default Q drain_soul Fluffy_Pillow 337352.5/1100000: 31% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(3), devils_due, accelerando
4:23.923 default I corruption Fluffy_Pillow 139199.1/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(2), compounding_horror(4)
4:25.259 default G agony Fluffy_Pillow 122729.2/1100000: 11% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(2), compounding_horror(5)
4:26.597 default H life_tap Fluffy_Pillow 106284.0/1100000: 10% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls(2), compounding_horror(5), nefarious_pact
4:27.512 default M unstable_affliction Fluffy_Pillow 447605.1/1100000: 41% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls(2), compounding_horror(5), nefarious_pact
4:28.426 default M unstable_affliction Fluffy_Pillow 458940.7/1100000: 42% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(2), active_uas, nefarious_pact, accelerando
4:29.323 default N reap_souls Fluffy_Pillow 470236.1/1100000: 43% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls(3), active_uas(2), nefarious_pact, accelerando
4:29.323 default Q drain_soul Fluffy_Pillow 470236.1/1100000: 43% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(2), nefarious_pact, accelerando
4:35.016 default K unstable_affliction Fluffy_Pillow 245391.1/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), nefarious_pact, accelerando(2)
4:35.900 default Q drain_soul Fluffy_Pillow 256818.6/1100000: 23% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, nefarious_pact, accelerando(3)
4:37.976 default I corruption Fluffy_Pillow 184872.8/1100000: 17% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, nefarious_pact, accelerando(3)
4:38.846 default Q drain_soul Fluffy_Pillow 163210.6/1100000: 15% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, devils_due, accelerando(3)
4:42.129 default H life_tap Fluffy_Pillow 105791.5/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), devils_due
4:43.714 default G agony Fluffy_Pillow 455553.3/1100000: 41% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(4), devils_due, accelerando
4:45.273 default K unstable_affliction Fluffy_Pillow 442527.6/1100000: 40% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(4), devils_due, accelerando(2)
4:46.806 default K unstable_affliction Fluffy_Pillow 462168.7/1100000: 42% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas, accelerando(2)
4:48.097 default N reap_souls Fluffy_Pillow 478710.1/1100000: 44% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas(2), accelerando(3)
4:48.097 default Q drain_soul Fluffy_Pillow 478710.1/1100000: 44% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(3)
4:51.746 default J corruption Fluffy_Pillow 394263.6/1100000: 36% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), active_uas(2), accelerando(3)
4:53.018 default Q drain_soul Fluffy_Pillow 377840.2/1100000: 34% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), active_uas(2), accelerando(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 56948 56948 35847
Intellect 51433 49727 40032 (1278)
Spirit 0 0 0
Health 3416880 3416880 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 51433 49727 0
Crit 24.41% 24.41% 7764
Haste 12.48% 12.48% 4680
Damage / Heal Versatility 2.33% 2.33% 1107
ManaReg per Second 12373 12373 0
Mastery 120.66% 117.69% 11863
Armor 2020 2020 2020
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 910.00
Local Head Eyes of Azj'Aqir
ilevel: 905, stats: { 257 Armor, +3410 Sta, +2273 Int, +1094 Haste, +589 Vers }
Local Neck Beleron's Choker of Misery
ilevel: 905, stats: { +1918 Sta, +1727 Crit, +1295 Mastery }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Pillars of the Dark Portal
ilevel: 940, stats: { 314 Armor, +4726 Sta, +3150 Int, +1097 Crit, +822 Mastery, +658 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Bracers of Harnessed Flame
ilevel: 905, stats: { 139 Armor, +1918 Sta, +1278 Int, +595 Mastery, +351 Crit }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Spellblade's Gemmed Signet
ilevel: 905, stats: { +1918 Sta, +2073 Crit, +950 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Temporal Recalibration
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +636 Mastery, +311 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Pillars_of_the_Dark_Portal"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3518
neck=belerons_choker_of_misery,id=140899,bonus_id=3518,enchant=mark_of_the_trained_soldier
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518
back=cloak_of_temporal_recalibration,id=140910,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3518
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518
legs=pillars_of_the_dark_portal,id=132357,ilevel=940
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=spellblades_gemmed_signet,id=140895,bonus_id=3518,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=erratic_metronome,id=140792,bonus_id=3445
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=909.60
# gear_stamina=35847
# gear_intellect=40032
# gear_crit_rating=7612
# gear_haste_rating=4588
# gear_mastery_rating=11630
# gear_versatility_rating=1085
# gear_armor=2020
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Power_Cord_of_Lethtendris : 950432 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
950431.6 950431.6 1509.5 / 0.159% 212096.5 / 22.3% 32.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
27140.6 27140.6 Mana 0.00% 34.6 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Power_Cord_of_Lethtendris 950432
Agony 131212 13.8% 17.3 17.96sec 2277147 1850367 Periodic 190.2 138745 366590 206826 29.9% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.27 0.00 190.19 190.19 1.2307 1.5731 39335110.29 39335110.29 0.00 122755.73 1850367.40
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.4 70.12% 138744.66 13105 232209 138781.05 122599 155802 18503271 18503271 0.00
crit 56.8 29.88% 366589.89 30403 613033 366541.62 278915 435546 20831839 20831839 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 6914 0.7% 31.2 9.44sec 66405 0 Direct 31.2 54122 108508 66402 22.6%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.22 31.22 0.00 0.00 0.0000 0.0000 2072995.53 2072995.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.17 77.42% 54121.87 19946 192071 54201.63 34015 83794 1308088 1308088 0.00
crit 7.05 22.58% 108508.40 39893 384141 108361.50 0 235366 764908 764908 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 114735 12.1% 21.9 13.85sec 1568598 1306655 Periodic 189.7 121729 320962 181269 29.9% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.92 0.00 189.72 189.72 1.2005 1.5699 34391165.98 34391165.98 0.00 106090.24 1306655.24
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.0 70.12% 121728.74 268 199361 121798.48 104968 136195 16192657 16192657 0.00
crit 56.7 29.88% 320962.13 3979 526314 320914.55 265123 378378 18198509 18198509 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 113171 11.9% 64.3 4.61sec 527370 193116 Periodic 207.5 125082 252541 163439 30.1% 54.1%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.32 0.00 207.54 207.54 2.7309 0.7826 33920070.26 33920070.26 0.00 193116.10 193116.10
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 145.1 69.91% 125081.72 79288 161342 125152.70 112307 135569 18147956 18147956 0.00
crit 62.5 30.09% 252541.16 158575 322684 252628.00 222878 271902 15772114 15772114 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 24622 2.6% 49.4 5.97sec 149538 0 Direct 49.1 122224 244674 150253 22.9%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.36 49.13 0.00 0.00 0.0000 0.0000 7381839.45 7381839.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.89 77.11% 122224.45 81033 156060 122205.62 107090 134481 4630674 4630674 0.00
crit 11.24 22.89% 244673.62 162066 312119 244614.77 179136 287855 2751165 2751165 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Soul 17692 1.9% 14.9 18.49sec 355371 0 Direct 14.9 289500 577930 355356 22.8%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.92 14.92 0.00 0.00 0.0000 0.0000 5301347.23 5301347.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.51 77.16% 289499.93 186996 360133 289142.40 220655 341821 3332468 3332468 0.00
crit 3.41 22.84% 577930.29 373992 720265 556077.23 0 720265 1968879 1968879 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (462352) 0.0% (48.6%) 54.6 5.45sec 2534144 2146175

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.65 0.00 0.00 0.00 1.1808 0.0000 0.00 0.00 0.00 2146174.63 2146174.63
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 227438 23.9% 0.0 0.00sec 0 0 Periodic 139.2 292179 777906 489631 40.7% 65.0%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 139.22 139.22 0.0000 1.3997 68167397.08 68167397.08 0.00 349809.60 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.6 59.35% 292178.72 261 470633 292486.12 248391 340475 24141068 24141068 0.00
crit 56.6 40.65% 777905.55 700 1242470 778291.77 605925 957505 44026329 44026329 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 144281 15.2% 0.0 0.00sec 0 0 Periodic 82.6 309129 824959 523195 41.5% 38.1%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 82.61 82.61 0.0000 1.3852 43221343.97 43221343.97 0.00 377719.80 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.3 58.50% 309129.32 176 470633 310068.64 250071 384612 14939286 14939286 0.00
crit 34.3 41.50% 824959.35 700 1242470 826928.97 611671 1067737 28282058 28282058 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 80627 8.5% 0.0 0.00sec 0 0 Periodic 44.1 322847 857753 547008 41.9% 19.8%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 44.07 44.07 0.0000 1.3506 24108298.73 24108298.73 0.00 404997.71 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.6 58.09% 322846.81 262 470633 326170.73 102526 470633 8265973 8265973 0.00
crit 18.5 41.91% 857753.14 577 1242470 865140.86 0 1242470 15842326 15842326 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 8878 0.9% 0.0 0.00sec 0 0 Periodic 5.2 300123 796780 506588 41.6% 2.4%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 5.24 5.24 0.0000 1.3520 2654642.13 2654642.13 0.00 374684.85 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.1 58.43% 300122.95 365 470633 195103.22 0 470633 918960 918960 0.00
crit 2.2 41.57% 796780.29 3039 1242470 500785.55 0 1242470 1735682 1735682 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 1129 0.1% 0.0 0.00sec 0 0 Periodic 0.7 287556 770713 487838 41.5% 0.3%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.69 0.69 0.0000 1.3785 334528.37 334528.37 0.00 353998.28 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.4 58.55% 287555.98 1132 470633 36338.04 0 470633 115448 115448 0.00
crit 0.3 41.45% 770712.51 6023 1242470 91484.10 0 1242470 219080 219080 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 79734 / 79734
Doom Bolt 79734 8.4% 122.2 2.44sec 195661 82054 Direct 121.4 160172 320515 196926 22.9%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.17 121.38 0.00 0.00 2.3845 0.0000 23903427.90 23903427.90 0.00 82054.11 82054.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.56 77.08% 160172.07 133137 230339 160213.90 151520 168304 14985037 14985037 0.00
crit 27.83 22.92% 320515.03 266275 460678 320552.92 288531 353399 8918391 8918391 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Power_Cord_of_Lethtendris
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Power_Cord_of_Lethtendris
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Power_Cord_of_Lethtendris
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Power_Cord_of_Lethtendris
  • harmful:false
  • if_expr:
 
Life Tap 10.1 24.78sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.10 0.00 0.00 0.00 1.2200 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 13.3 23.21sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.28 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.3 156.89sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.31 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.9 0.0 15.5sec 15.5sec 77.90% 77.90% 2.1(2.1) 19.1

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.08%
  • accelerando_2:23.62%
  • accelerando_3:14.42%
  • accelerando_4:6.92%
  • accelerando_5:3.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 31.1 23.5 9.6sec 0.0sec 67.76% 67.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:41.72%
  • active_uas_2:17.16%
  • active_uas_3:8.64%
  • active_uas_4:0.20%
  • active_uas_5:0.04%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 32.1 33.8 9.3sec 4.5sec 54.11% 100.00% 0.5(0.5) 0.4

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:28.94%
  • compounding_horror_2:15.32%
  • compounding_horror_3:6.63%
  • compounding_horror_4:2.32%
  • compounding_horror_5:0.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 13.3 0.0 23.1sec 23.1sec 73.03% 73.03% 0.0(0.0) 12.4

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:73.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.5sec 68.5sec 8.79% 8.79% 0.0(0.0) 3.3

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.79%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.5 0.0 68.8sec 68.1sec 13.65% 13.65% 0.0(0.0) 3.3

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.65%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 167.9sec 0.0sec 38.15% 38.15% 0.0(0.0) 1.9

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:38.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.3 0.0 156.6sec 156.6sec 12.83% 12.83% 0.0(0.0) 2.2

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:12.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 13.9 32.7 22.3sec 6.8sec 73.82% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:24.74%
  • tormented_souls_2:18.68%
  • tormented_souls_3:12.81%
  • tormented_souls_4:8.45%
  • tormented_souls_5:4.66%
  • tormented_souls_6:2.49%
  • tormented_souls_7:1.29%
  • tormented_souls_8:0.43%
  • tormented_souls_9:0.16%
  • tormented_souls_10:0.08%
  • tormented_souls_11:0.03%
  • tormented_souls_12:0.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 6.6 38.5sec
t18_2pc_affliction 54.6 5.5sec
soul_conduit 10.9 24.9sec
souls_consumed 45.1 23.1sec

Resources

Resource Usage Type Count Total Average RPE APR
Power_Cord_of_Lethtendris
agony Mana 17.3 570030.0 33000.0 32999.6 69.0
corruption Mana 21.9 723519.9 33000.0 33000.1 47.5
drain_soul Mana 207.5 6848947.8 33000.0 106483.6 5.0
unstable_affliction Soul Shard 54.6 54.6 1.0 1.0 2534121.3
pet - doomguard
doom_bolt Energy 122.2 4275.9 35.0 35.0 5590.3
Resource Gains Type Count Total Average Overflow
life_tap Mana 10.10 3334299.42 (45.57%) 330000.00 0.00 0.00%
agony Soul Shard 35.00 35.00 (66.61%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.57 0.57 (1.09%) 1.00 0.00 0.00%
mp5_regen Mana 361.28 3982894.36 (54.43%) 11024.35 22258.25 0.56%
soul_conduit Soul Shard 10.92 10.92 (20.78%) 1.00 0.00 0.00%
power_cord_of_lethtendris Soul Shard 6.06 6.06 (11.52%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 196.83 4234.52 (100.00%) 21.51 118.12 2.71%
Resource RPS-Gain RPS-Loss
Health 0.00 11586.14
Mana 24389.48 27140.61
Soul Shard 0.18 0.18
Combat End Resource Mean Min Max
Mana 273739.32 39408.90 513516.46
Soul Shard 0.90 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Power_Cord_of_Lethtendris Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Power_Cord_of_Lethtendris Damage Per Second
Count 4999
Mean 950431.62
Minimum 767490.89
Maximum 1172471.30
Spread ( max - min ) 404980.41
Range [ ( max - min ) / 2 * 100% ] 21.31%
Standard Deviation 54452.6076
5th Percentile 864763.14
95th Percentile 1041006.22
( 95th Percentile - 5th Percentile ) 176243.08
Mean Distribution
Standard Deviation 770.1532
95.00% Confidence Intervall ( 948922.14 - 951941.09 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 127
0.1% Error 12610
0.1 Scale Factor Error with Delta=300 25311684
0.05 Scale Factor Error with Delta=300 101246735
0.01 Scale Factor Error with Delta=300 2531168354
Priority Target DPS
Sample Data Power_Cord_of_Lethtendris Priority Target Damage Per Second
Count 4999
Mean 950431.62
Minimum 767490.89
Maximum 1172471.30
Spread ( max - min ) 404980.41
Range [ ( max - min ) / 2 * 100% ] 21.31%
Standard Deviation 54452.6076
5th Percentile 864763.14
95th Percentile 1041006.22
( 95th Percentile - 5th Percentile ) 176243.08
Mean Distribution
Standard Deviation 770.1532
95.00% Confidence Intervall ( 948922.14 - 951941.09 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 127
0.1% Error 12610
0.1 Scale Factor Error with Delta=300 25311684
0.05 Scale Factor Error with Delta=300 101246735
0.01 Scale Factor Error with Delta=300 2531168354
DPS(e)
Sample Data Power_Cord_of_Lethtendris Damage Per Second (Effective)
Count 4999
Mean 950431.62
Minimum 767490.89
Maximum 1172471.30
Spread ( max - min ) 404980.41
Range [ ( max - min ) / 2 * 100% ] 21.31%
Damage
Sample Data Power_Cord_of_Lethtendris Damage
Count 4999
Mean 260888739.02
Minimum 181931105.48
Maximum 351379884.54
Spread ( max - min ) 169448779.06
Range [ ( max - min ) / 2 * 100% ] 32.48%
DTPS
Sample Data Power_Cord_of_Lethtendris Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Power_Cord_of_Lethtendris Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Power_Cord_of_Lethtendris Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Power_Cord_of_Lethtendris Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Power_Cord_of_Lethtendris Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Power_Cord_of_Lethtendris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Power_Cord_of_LethtendrisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Power_Cord_of_Lethtendris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 1.29 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 11.74 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
D 2.31 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
E 0.96 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 1.78 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
G 5.53 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
H 9.53 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
I 7.19 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
J 12.95 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
K 6.06 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
L 0.74 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
M 20.38 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
N 27.69 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
O 8.50 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
P 3.49 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
Q 0.57 life_tap,if=mana.pct<=10
R 52.25 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACILMMDORNJRCNMRNJRGNPRNJRHNMRCNJRRHNKMJORCNMMRJNMMCRINMMRLCORHILMMRGINMMDEORRHGINMORINRCHNMJORNRCHINPRNRJCNMMORRHRINRCRNRJRRHGNMORJRNRHNMRCJORNRIGNMMDORRHRKRFRKRCRBKJKRKRR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Power_Cord_of_Lethtendris 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Power_Cord_of_Lethtendris 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Power_Cord_of_Lethtendris 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.326 default I corruption Fluffy_Pillow 1088873.3/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:02.330 default L unstable_affliction Fluffy_Pillow 1072721.8/1100000: 98% mana | 4.0/5: 80% soul_shard bloodlust, accelerando(2), potion_of_prolonged_power
0:03.316 default M unstable_affliction Fluffy_Pillow 1089268.2/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, active_uas, accelerando(2), potion_of_prolonged_power
0:04.302 default M unstable_affliction Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), accelerando(3), potion_of_prolonged_power
0:05.274 default D soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(3), accelerando(3), potion_of_prolonged_power
0:05.274 default O reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, active_uas(3), accelerando(3), potion_of_prolonged_power
0:05.274 default R drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), accelerando(3), potion_of_prolonged_power
0:10.716 default N unstable_affliction Fluffy_Pillow 918340.6/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(4), potion_of_prolonged_power
0:11.672 default J corruption Fluffy_Pillow 934930.1/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas, accelerando(4), potion_of_prolonged_power
0:12.625 default R drain_soul Fluffy_Pillow 917910.5/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, active_uas, accelerando, potion_of_prolonged_power
0:16.192 default C agony Fluffy_Pillow 812198.9/1100000: 74% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), active_uas, accelerando(2), potion_of_prolonged_power
0:17.181 default N unstable_affliction Fluffy_Pillow 795795.6/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:18.168 default M unstable_affliction Fluffy_Pillow 812358.8/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas, accelerando(2), potion_of_prolonged_power
0:19.157 default R drain_soul Fluffy_Pillow 828955.5/1100000: 75% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas(2), accelerando(2), potion_of_prolonged_power
0:24.633 default N unstable_affliction Fluffy_Pillow 656599.9/1100000: 60% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, tormented_souls(3), compounding_horror(3), accelerando, potion_of_prolonged_power
0:25.639 default J corruption Fluffy_Pillow 673194.6/1100000: 61% mana | 0.0/5: 0% soul_shard bloodlust, tormented_souls(4), active_uas, accelerando, potion_of_prolonged_power
0:26.645 default R drain_soul Fluffy_Pillow 656789.3/1100000: 60% mana | 0.0/5: 0% soul_shard bloodlust, tormented_souls(4), active_uas, accelerando, potion_of_prolonged_power
0:31.527 default G agony Fluffy_Pillow 506344.0/1100000: 46% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(6), compounding_horror, accelerando(2), potion_of_prolonged_power
0:32.514 default N unstable_affliction Fluffy_Pillow 489907.2/1100000: 45% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(6), compounding_horror, accelerando(2), potion_of_prolonged_power
0:33.501 default P reap_souls Fluffy_Pillow 506470.3/1100000: 46% mana | 0.0/5: 0% soul_shard bloodlust, tormented_souls(6), active_uas, accelerando(2), potion_of_prolonged_power
0:33.501 default R drain_soul Fluffy_Pillow 506470.3/1100000: 46% mana | 0.0/5: 0% soul_shard bloodlust, deadwind_harvester, active_uas, accelerando(2), potion_of_prolonged_power
0:39.006 default N unstable_affliction Fluffy_Pillow 300357.8/1100000: 27% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, compounding_horror(4), nefarious_pact, potion_of_prolonged_power
0:39.759 default J corruption Fluffy_Pillow 312580.6/1100000: 28% mana | 0.0/5: 0% soul_shard bloodlust, deadwind_harvester, tormented_souls, active_uas, nefarious_pact, accelerando, potion_of_prolonged_power
0:40.515 default R drain_soul Fluffy_Pillow 292051.3/1100000: 27% mana | 0.0/5: 0% soul_shard bloodlust, deadwind_harvester, tormented_souls, active_uas, nefarious_pact, accelerando, potion_of_prolonged_power
0:44.090 default H life_tap Fluffy_Pillow 106414.6/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), nefarious_pact, accelerando, potion_of_prolonged_power
0:44.982 default N unstable_affliction Fluffy_Pillow 447761.9/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), nefarious_pact, accelerando(2), potion_of_prolonged_power
0:45.858 default M unstable_affliction Fluffy_Pillow 459070.9/1100000: 42% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:46.720 default R drain_soul Fluffy_Pillow 470387.8/1100000: 43% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), nefarious_pact, accelerando(3), potion_of_prolonged_power
0:51.320 default C agony Fluffy_Pillow 300204.2/1100000: 27% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror, devils_due, accelerando(5), potion_of_prolonged_power
0:52.767 default N unstable_affliction Fluffy_Pillow 285776.0/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(2), devils_due, accelerando, potion_of_prolonged_power
0:54.314 default J corruption Fluffy_Pillow 305406.8/1100000: 28% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), active_uas, devils_due, accelerando(2), potion_of_prolonged_power
0:55.836 default R drain_soul Fluffy_Pillow 292053.8/1100000: 27% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), active_uas, accelerando(2), potion_of_prolonged_power
1:02.313 default R drain_soul Fluffy_Pillow 114151.3/1100000: 10% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(2), active_uas, nefarious_pact, accelerando(4)
1:03.598 default H life_tap Fluffy_Pillow 65462.9/1100000: 6% mana | 3.0/5: 60% soul_shard tormented_souls(5), compounding_horror(2), nefarious_pact, accelerando(5)
1:04.433 default N unstable_affliction Fluffy_Pillow 406608.8/1100000: 37% mana | 3.0/5: 60% soul_shard tormented_souls(5), compounding_horror(2), nefarious_pact
1:05.338 default K unstable_affliction Fluffy_Pillow 417893.5/1100000: 38% mana | 4.0/5: 80% soul_shard tormented_souls(5), active_uas, nefarious_pact
1:06.246 default M unstable_affliction Fluffy_Pillow 429215.6/1100000: 39% mana | 3.0/5: 60% soul_shard tormented_souls(6), active_uas(2), nefarious_pact
1:07.155 default J corruption Fluffy_Pillow 440550.2/1100000: 40% mana | 2.0/5: 40% soul_shard tormented_souls(6), active_uas(3), nefarious_pact
1:08.062 default O reap_souls Fluffy_Pillow 418859.9/1100000: 38% mana | 3.0/5: 60% soul_shard tormented_souls(7), active_uas(3), devils_due
1:08.062 default R drain_soul Fluffy_Pillow 418859.9/1100000: 38% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(3), devils_due
1:10.521 default C agony Fluffy_Pillow 383603.0/1100000: 35% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(2), devils_due, accelerando
1:12.067 default N unstable_affliction Fluffy_Pillow 370220.2/1100000: 34% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror, devils_due, accelerando
1:13.615 default M unstable_affliction Fluffy_Pillow 389862.8/1100000: 35% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas, devils_due, accelerando
1:15.163 default M unstable_affliction Fluffy_Pillow 409506.5/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(2), devils_due, accelerando(2)
1:16.685 default R drain_soul Fluffy_Pillow 429153.5/1100000: 39% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(3), accelerando(2)
1:22.886 default J corruption Fluffy_Pillow 278110.1/1100000: 25% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), active_uas(2)
1:24.212 default N unstable_affliction Fluffy_Pillow 261644.4/1100000: 24% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(3)
1:25.539 default M unstable_affliction Fluffy_Pillow 278191.1/1100000: 25% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas
1:26.865 default M unstable_affliction Fluffy_Pillow 294726.1/1100000: 27% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), accelerando
1:28.170 default C agony Fluffy_Pillow 311285.3/1100000: 28% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), active_uas(3), accelerando
1:29.477 default R drain_soul Fluffy_Pillow 294869.8/1100000: 27% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas(3), accelerando
1:35.685 default I corruption Fluffy_Pillow 143820.2/1100000: 13% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), accelerando(2)
1:36.966 default N unstable_affliction Fluffy_Pillow 127356.2/1100000: 12% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), accelerando(2)
1:38.248 default M unstable_affliction Fluffy_Pillow 143905.2/1100000: 13% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(2)
1:39.531 default M unstable_affliction Fluffy_Pillow 160173.1/1100000: 15% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas
1:40.857 default R drain_soul Fluffy_Pillow 176708.1/1100000: 16% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), accelerando
1:43.774 default L unstable_affliction Fluffy_Pillow 114722.0/1100000: 10% mana | 4.0/5: 80% soul_shard tormented_souls(3), active_uas(2), accelerando
1:45.078 default C agony Fluffy_Pillow 131268.4/1100000: 12% mana | 3.0/5: 60% soul_shard tormented_souls(3), active_uas(2), accelerando
1:46.382 default O reap_souls Fluffy_Pillow 114814.9/1100000: 10% mana | 3.0/5: 60% soul_shard tormented_souls(4), active_uas(2), accelerando
1:46.382 default R drain_soul Fluffy_Pillow 114814.9/1100000: 10% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(2), accelerando
1:48.427 default H life_tap Fluffy_Pillow 74763.9/1100000: 7% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror, accelerando
1:49.734 default I corruption Fluffy_Pillow 421348.5/1100000: 38% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror, accelerando
1:51.040 default L unstable_affliction Fluffy_Pillow 405145.7/1100000: 37% mana | 4.0/5: 80% soul_shard deadwind_harvester, compounding_horror, accelerando(2)
1:52.323 default M unstable_affliction Fluffy_Pillow 421838.5/1100000: 38% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas, accelerando(3)
1:53.582 default M unstable_affliction Fluffy_Pillow 437887.5/1100000: 40% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(2)
1:54.910 default R drain_soul Fluffy_Pillow 454447.9/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(3), accelerando
2:03.053 default G agony Fluffy_Pillow 262983.2/1100000: 24% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(4)
2:04.294 default I corruption Fluffy_Pillow 246548.6/1100000: 22% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(4)
2:05.534 default N unstable_affliction Fluffy_Pillow 230146.1/1100000: 21% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), accelerando(5)
2:06.755 default M unstable_affliction Fluffy_Pillow 246712.8/1100000: 22% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas, accelerando(5)
2:07.975 default M unstable_affliction Fluffy_Pillow 262090.2/1100000: 24% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas(2)
2:09.302 default D soul_harvest Fluffy_Pillow 278637.9/1100000: 25% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas(3), accelerando
2:09.302 default E potion Fluffy_Pillow 278637.9/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(2), active_uas(3), accelerando
2:09.302 default O reap_souls Fluffy_Pillow 278637.9/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(2), active_uas(3), accelerando, potion_of_prolonged_power
2:09.302 default R drain_soul Fluffy_Pillow 278637.9/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
2:15.558 default R drain_soul Fluffy_Pillow 128730.7/1100000: 12% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, compounding_horror, active_uas, accelerando(3), potion_of_prolonged_power
2:17.481 default H life_tap Fluffy_Pillow 87977.2/1100000: 8% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, accelerando(3), potion_of_prolonged_power
2:18.743 default G agony Fluffy_Pillow 434545.7/1100000: 40% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, accelerando(3), potion_of_prolonged_power
2:20.003 default I corruption Fluffy_Pillow 418087.9/1100000: 38% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls, compounding_horror, accelerando(3), potion_of_prolonged_power
2:21.263 default N unstable_affliction Fluffy_Pillow 401630.1/1100000: 37% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls, compounding_horror, accelerando(3), potion_of_prolonged_power
2:22.524 default M unstable_affliction Fluffy_Pillow 417433.0/1100000: 38% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, active_uas, accelerando, potion_of_prolonged_power
2:23.830 default O reap_souls Fluffy_Pillow 434004.8/1100000: 39% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls, active_uas(2), accelerando, potion_of_prolonged_power
2:23.830 default R drain_soul Fluffy_Pillow 434004.8/1100000: 39% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(2), accelerando, potion_of_prolonged_power
2:31.867 default I corruption Fluffy_Pillow 239992.0/1100000: 22% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, accelerando(2), potion_of_prolonged_power
2:33.151 default N unstable_affliction Fluffy_Pillow 223566.8/1100000: 20% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, accelerando(2), potion_of_prolonged_power
2:34.432 default R drain_soul Fluffy_Pillow 240031.3/1100000: 22% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas, potion_of_prolonged_power
2:40.841 default C agony Fluffy_Pillow 91121.9/1100000: 8% mana | 0.0/5: 0% soul_shard tormented_souls(3), compounding_horror, active_uas, accelerando(3), potion_of_prolonged_power
2:42.102 default H life_tap Fluffy_Pillow 74677.2/1100000: 7% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror, accelerando(3), potion_of_prolonged_power
2:43.362 default N unstable_affliction Fluffy_Pillow 421219.4/1100000: 38% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror, accelerando(3), potion_of_prolonged_power
2:44.620 default M unstable_affliction Fluffy_Pillow 437735.3/1100000: 40% mana | 1.0/5: 20% soul_shard tormented_souls(3), active_uas, accelerando(3), potion_of_prolonged_power
2:45.882 default J corruption Fluffy_Pillow 454303.7/1100000: 41% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas(2), accelerando(3), potion_of_prolonged_power
2:47.144 default O reap_souls Fluffy_Pillow 437872.2/1100000: 40% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas(2), accelerando(3), potion_of_prolonged_power
2:47.144 default R drain_soul Fluffy_Pillow 437872.2/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(3), potion_of_prolonged_power
2:53.261 default N unstable_affliction Fluffy_Pillow 283296.4/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), potion_of_prolonged_power
2:54.589 default R drain_soul Fluffy_Pillow 299855.6/1100000: 27% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, nefarious_pact, potion_of_prolonged_power
2:59.078 default C agony Fluffy_Pillow 125553.2/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), nefarious_pact, accelerando, potion_of_prolonged_power
2:59.969 default H life_tap Fluffy_Pillow 103933.1/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), nefarious_pact, accelerando(2), potion_of_prolonged_power
3:00.846 default I corruption Fluffy_Pillow 445254.1/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), nefarious_pact, accelerando(2), potion_of_prolonged_power
3:01.724 default N unstable_affliction Fluffy_Pillow 423587.9/1100000: 39% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, nefarious_pact, accelerando(2), potion_of_prolonged_power
3:02.602 default P reap_souls Fluffy_Pillow 434921.8/1100000: 40% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas, nefarious_pact, accelerando(2), potion_of_prolonged_power
3:02.602 default R drain_soul Fluffy_Pillow 434921.8/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, nefarious_pact, accelerando(2), potion_of_prolonged_power
3:08.098 default N unstable_affliction Fluffy_Pillow 209489.4/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, devils_due, potion_of_prolonged_power
3:09.673 default R drain_soul Fluffy_Pillow 229128.5/1100000: 21% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, devils_due
3:14.142 default J corruption Fluffy_Pillow 152853.9/1100000: 14% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(2), active_uas, devils_due
3:15.717 default C agony Fluffy_Pillow 139493.0/1100000: 13% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(2)
3:17.044 default N unstable_affliction Fluffy_Pillow 123039.8/1100000: 11% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(2)
3:18.370 default M unstable_affliction Fluffy_Pillow 139718.9/1100000: 13% mana | 2.0/5: 40% soul_shard tormented_souls(4), active_uas, accelerando
3:19.675 default M unstable_affliction Fluffy_Pillow 156278.0/1100000: 14% mana | 1.0/5: 20% soul_shard tormented_souls(4), active_uas(2), accelerando
3:20.979 default O reap_souls Fluffy_Pillow 172824.5/1100000: 16% mana | 0.0/5: 0% soul_shard tormented_souls(4), active_uas(3), accelerando
3:20.979 default R drain_soul Fluffy_Pillow 172824.5/1100000: 16% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), accelerando
3:22.936 default R drain_soul Fluffy_Pillow 131656.9/1100000: 12% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), accelerando
3:24.904 default H life_tap Fluffy_Pillow 90628.9/1100000: 8% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(3), accelerando
3:26.210 default R drain_soul Fluffy_Pillow 437200.7/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(2), accelerando
3:28.284 default I corruption Fluffy_Pillow 397783.2/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, accelerando(2)
3:29.565 default N unstable_affliction Fluffy_Pillow 381319.2/1100000: 35% mana | 1.0/5: 20% soul_shard deadwind_harvester, accelerando(2)
3:30.847 default R drain_soul Fluffy_Pillow 397369.0/1100000: 36% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas
3:33.704 default C agony Fluffy_Pillow 334739.1/1100000: 30% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(2)
3:34.985 default R drain_soul Fluffy_Pillow 318275.2/1100000: 29% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(2)
3:38.591 default N unstable_affliction Fluffy_Pillow 233617.3/1100000: 21% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, accelerando(3)
3:39.851 default R drain_soul Fluffy_Pillow 250159.5/1100000: 23% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(3)
3:41.743 default J corruption Fluffy_Pillow 208999.0/1100000: 19% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas, accelerando(3)
3:43.004 default R drain_soul Fluffy_Pillow 192554.4/1100000: 18% mana | 0.0/5: 0% soul_shard tormented_souls(2), compounding_horror, active_uas, accelerando(3)
3:45.697 default R drain_soul Fluffy_Pillow 127612.3/1100000: 12% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror, active_uas
3:47.650 default H life_tap Fluffy_Pillow 86006.4/1100000: 8% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(2), accelerando
3:48.954 default G agony Fluffy_Pillow 432552.8/1100000: 39% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(2), accelerando
3:50.258 default N unstable_affliction Fluffy_Pillow 416099.3/1100000: 38% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(2), accelerando
3:51.561 default M unstable_affliction Fluffy_Pillow 432633.1/1100000: 39% mana | 1.0/5: 20% soul_shard tormented_souls(4), active_uas, nefarious_pact, accelerando
3:52.453 default O reap_souls Fluffy_Pillow 443951.7/1100000: 40% mana | 0.0/5: 0% soul_shard tormented_souls(4), active_uas(2), nefarious_pact, accelerando
3:52.453 default R drain_soul Fluffy_Pillow 443951.7/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), nefarious_pact, accelerando
3:55.715 default J corruption Fluffy_Pillow 320906.5/1100000: 29% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas(2), nefarious_pact, accelerando(3)
3:56.577 default R drain_soul Fluffy_Pillow 299223.4/1100000: 27% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas, nefarious_pact, accelerando(3)
3:58.064 default N unstable_affliction Fluffy_Pillow 252990.8/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, nefarious_pact, accelerando(4)
3:58.913 default R drain_soul Fluffy_Pillow 264323.6/1100000: 24% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, nefarious_pact, accelerando(4)
4:03.126 default H life_tap Fluffy_Pillow 87573.7/1100000: 8% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(4), active_uas, devils_due, accelerando(2)
4:04.648 default N unstable_affliction Fluffy_Pillow 437220.8/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(5), devils_due, accelerando(2)
4:06.170 default M unstable_affliction Fluffy_Pillow 456867.9/1100000: 42% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas, devils_due, accelerando(2)
4:07.690 default R drain_soul Fluffy_Pillow 476574.1/1100000: 43% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), devils_due, accelerando(4)
4:10.055 default C agony Fluffy_Pillow 442143.1/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), devils_due, accelerando(4)
4:11.526 default J corruption Fluffy_Pillow 429101.8/1100000: 39% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, active_uas(2), accelerando(5)
4:12.748 default O reap_souls Fluffy_Pillow 411544.8/1100000: 37% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror, active_uas(2)
4:12.748 default R drain_soul Fluffy_Pillow 411544.8/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, active_uas(2)
4:16.550 default N unstable_affliction Fluffy_Pillow 326953.1/1100000: 30% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2)
4:17.878 default R drain_soul Fluffy_Pillow 343512.3/1100000: 31% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas
4:24.348 default I corruption Fluffy_Pillow 194416.5/1100000: 18% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), nefarious_pact, accelerando
4:25.239 default G agony Fluffy_Pillow 172722.4/1100000: 16% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), nefarious_pact, accelerando
4:26.132 default N unstable_affliction Fluffy_Pillow 151053.7/1100000: 14% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), nefarious_pact, accelerando
4:27.023 default M unstable_affliction Fluffy_Pillow 162359.6/1100000: 15% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, nefarious_pact, accelerando
4:27.916 default M unstable_affliction Fluffy_Pillow 173690.9/1100000: 16% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas(2), nefarious_pact, accelerando
4:28.807 default D soul_harvest Fluffy_Pillow 184996.8/1100000: 17% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(3), nefarious_pact, accelerando
4:28.807 default O reap_souls Fluffy_Pillow 184996.8/1100000: 17% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls, active_uas(3), nefarious_pact, accelerando
4:28.807 default R drain_soul Fluffy_Pillow 184996.8/1100000: 17% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(3), nefarious_pact, accelerando
4:30.870 default R drain_soul Fluffy_Pillow 112321.8/1100000: 10% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls, active_uas(3), nefarious_pact
4:32.347 default H life_tap Fluffy_Pillow 64739.0/1100000: 6% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls, active_uas(2), nefarious_pact
4:33.256 default R drain_soul Fluffy_Pillow 406073.6/1100000: 37% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls, active_uas, nefarious_pact
4:34.598 default K unstable_affliction Fluffy_Pillow 357102.3/1100000: 32% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, devils_due, accelerando
4:36.145 default R drain_soul Fluffy_Pillow 376732.2/1100000: 34% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls, active_uas, devils_due, accelerando
4:38.344 default F corruption Fluffy_Pillow 338667.4/1100000: 31% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls, devils_due, accelerando(2)
4:39.865 default R drain_soul Fluffy_Pillow 325301.6/1100000: 30% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls, devils_due, accelerando(2)
4:42.164 default K unstable_affliction Fluffy_Pillow 288978.7/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, devils_due, accelerando(2)
4:43.686 default R drain_soul Fluffy_Pillow 308625.8/1100000: 28% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls, active_uas, accelerando(2)
4:45.663 default C agony Fluffy_Pillow 267967.5/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls(2)
4:46.990 default R drain_soul Fluffy_Pillow 251514.2/1100000: 23% mana | 0.0/5: 0% soul_shard tormented_souls(2), compounding_horror
4:50.876 default B reap_souls Fluffy_Pillow 168747.1/1100000: 15% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror, accelerando(2)
4:50.876 default K unstable_affliction Fluffy_Pillow 168747.1/1100000: 15% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, accelerando(2)
4:52.159 default J corruption Fluffy_Pillow 185309.0/1100000: 17% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(2)
4:53.441 default K unstable_affliction Fluffy_Pillow 168857.9/1100000: 15% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(2)
4:54.725 default R drain_soul Fluffy_Pillow 185432.7/1100000: 17% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(2)
4:56.757 default K unstable_affliction Fluffy_Pillow 145663.3/1100000: 13% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas(2), accelerando(2)
4:58.040 default R drain_soul Fluffy_Pillow 162225.1/1100000: 15% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas(3), accelerando(2)
5:00.007 default R drain_soul Fluffy_Pillow 121557.3/1100000: 11% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 56502 56502 35517
Intellect 51202 49496 39812 (1278)
Spirit 0 0 0
Health 3390120 3390120 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 51202 49496 0
Crit 22.92% 22.92% 7170
Haste 13.36% 13.36% 5009
Damage / Heal Versatility 2.33% 2.33% 1107
ManaReg per Second 12469 12469 0
Mastery 117.03% 114.03% 11395
Armor 2007 2007 2007
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 910.00
Local Head Eyes of Azj'Aqir
ilevel: 905, stats: { 257 Armor, +3410 Sta, +2273 Int, +1094 Haste, +589 Vers }
Local Neck Beleron's Choker of Misery
ilevel: 905, stats: { +1918 Sta, +1727 Crit, +1295 Mastery }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Power Cord of Lethtendris
ilevel: 940, stats: { 202 Armor, +3544 Sta, +2362 Int, +514 Crit, +925 Haste }
Local Legs Master Warmage's Leggings
ilevel: 905, stats: { 277 Armor, +3410 Sta, +2273 Int, +914 Mastery, +769 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Bracers of Harnessed Flame
ilevel: 905, stats: { 139 Armor, +1918 Sta, +1278 Int, +595 Mastery, +351 Crit }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Spellblade's Gemmed Signet
ilevel: 905, stats: { +1918 Sta, +2073 Crit, +950 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Temporal Recalibration
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +636 Mastery, +311 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Power_Cord_of_Lethtendris"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3518
neck=belerons_choker_of_misery,id=140899,bonus_id=3518,enchant=mark_of_the_trained_soldier
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518
back=cloak_of_temporal_recalibration,id=140910,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3518
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=power_cord_of_lethtendris,id=132457,ilevel=940
legs=master_warmages_leggings,id=140852,bonus_id=3518
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=spellblades_gemmed_signet,id=140895,bonus_id=3518,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=erratic_metronome,id=140792,bonus_id=3445
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=909.60
# gear_stamina=35517
# gear_intellect=39812
# gear_crit_rating=7029
# gear_haste_rating=4911
# gear_mastery_rating=11172
# gear_versatility_rating=1085
# gear_armor=2007
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Prydaz_Xavarics_Magnum_Opus : 936111 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
936111.2 936111.2 1439.9 / 0.154% 204217.1 / 21.8% 29.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
29186.7 29186.7 Mana 0.00% 33.0 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Prydaz_Xavarics_Magnum_Opus 936111
Agony 135823 14.5% 17.3 18.11sec 2357970 1978392 Periodic 195.9 142049 376613 207818 28.0% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.27 0.00 195.95 195.95 1.1919 1.5270 40723218.52 40723218.52 0.00 127343.63 1978391.88
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 141.0 71.96% 142048.91 13364 236797 142077.74 125314 157922 20029454 20029454 0.00
crit 54.9 28.04% 376613.07 31004 625145 376518.00 304078 445545 20693765 20693765 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 6476 0.7% 26.1 11.34sec 74464 0 Direct 26.1 61535 122758 74462 21.1%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.07 26.07 0.00 0.00 0.0000 0.0000 1941072.09 1941072.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.56 78.88% 61535.16 19678 189612 61753.81 36302 95297 1265328 1265328 0.00
crit 5.50 21.12% 122757.76 39356 379224 122655.64 0 321377 675744 675744 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 118640 12.7% 21.9 13.85sec 1621273 1390256 Periodic 195.4 124617 329538 181999 28.0% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 0.00 195.41 195.41 1.1662 1.5245 35565524.77 35565524.77 0.00 109940.14 1390255.83
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 140.7 72.00% 124616.86 1723 203299 124666.20 107909 137748 17533148 17533148 0.00
crit 54.7 28.00% 329537.73 4602 536709 329566.18 272012 387610 18032377 18032377 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 118725 12.7% 66.1 4.49sec 538082 193052 Periodic 226.1 122088 246434 157388 28.4% 57.2%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.15 0.00 226.14 226.14 2.7872 0.7595 35592206.81 35592206.81 0.00 193051.90 193051.90
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 161.9 71.61% 122088.14 78221 159277 122155.99 110556 131107 19770261 19770261 0.00
crit 64.2 28.39% 246433.90 156441 318553 246524.65 214534 266268 15821946 15821946 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 24609 2.6% 51.6 5.72sec 143109 0 Direct 51.3 118693 237440 143802 21.1%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.56 51.31 0.00 0.00 0.0000 0.0000 7378026.05 7378026.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.46 78.85% 118692.80 79942 154062 118692.53 105923 129338 4801951 4801951 0.00
crit 10.85 21.15% 237440.09 159885 308124 237363.12 183369 293100 2576075 2576075 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Soul 18956 2.0% 16.7 16.86sec 341057 0 Direct 16.7 281735 563285 341061 21.1%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.66 16.66 0.00 0.00 0.0000 0.0000 5682530.45 5682530.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.15 78.93% 281734.65 184480 355523 281385.87 217384 333332 3705132 3705132 0.00
crit 3.51 21.07% 563285.49 368960 711046 544397.14 0 711046 1977398 1977398 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (432832) 0.0% (46.2%) 48.5 6.16sec 2670728 2319969

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.52 0.00 0.00 0.00 1.1512 0.0000 0.00 0.00 0.00 2319968.96 2319968.96
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 190904 20.4% 0.0 0.00sec 0 0 Periodic 111.2 310630 827253 514753 39.5% 50.6%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 111.19 111.19 0.0000 1.3657 57233867.00 57233867.00 0.00 376898.14 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.3 60.49% 310629.65 161 479928 311078.07 259560 368678 20893335 20893335 0.00
crit 43.9 39.51% 827252.69 361 1267010 828206.12 617546 1017692 36340532 36340532 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 150917 16.1% 0.0 0.00sec 0 0 Periodic 82.5 328928 875747 548001 40.1% 37.1%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 82.48 82.48 0.0000 1.3513 45195673.88 45195673.88 0.00 405520.58 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.4 59.94% 328927.77 153 479928 329705.58 266654 393163 16259552 16259552 0.00
crit 33.0 40.06% 875746.94 373 1267010 877470.41 632192 1122054 28936122 28936122 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 84293 9.0% 0.0 0.00sec 0 0 Periodic 44.7 338546 898148 563067 40.1% 19.6%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 44.68 44.68 0.0000 1.3167 25158176.96 25158176.96 0.00 427620.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.8 59.88% 338545.52 212 479928 341945.18 250081 479928 9057660 9057660 0.00
crit 17.9 40.12% 898148.32 522 1267010 907027.43 535436 1267010 16100517 16100517 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 5753 0.6% 0.0 0.00sec 0 0 Periodic 3.3 310090 834169 524098 40.8% 1.5%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 3.26 3.26 0.0000 1.3672 1710661.97 1710661.97 0.00 383384.57 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.9 59.18% 310090.19 264 479928 151789.42 0 479928 598880 598880 0.00
crit 1.3 40.82% 834169.31 6411 1267010 382113.18 0 1267010 1111782 1111782 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 964 0.1% 0.0 0.00sec 0 0 Periodic 0.6 300329 802398 496722 39.1% 0.3%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.57 0.57 0.0000 1.3833 283486.26 283486.26 0.00 359298.18 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 60.88% 300329.19 2314 479928 33011.64 0 479928 104355 104355 0.00
crit 0.2 39.12% 802397.88 6543 1267010 78375.41 0 1267010 179131 179131 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 80049 / 80049
Doom Bolt 80049 8.6% 125.8 2.37sec 190819 82379 Direct 125.0 158637 317170 192062 21.1%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.78 124.97 0.00 0.00 2.3163 0.0000 24001419.49 24001419.49 0.00 82379.46 82379.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.62 78.92% 158637.42 131346 227391 158679.92 149381 165317 15644914 15644914 0.00
crit 26.35 21.08% 317169.75 262692 454781 317228.95 288087 357850 8356506 8356506 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Prydaz_Xavarics_Magnum_Opus
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Prydaz_Xavarics_Magnum_Opus
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Prydaz_Xavarics_Magnum_Opus
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Prydaz_Xavarics_Magnum_Opus
  • harmful:false
  • if_expr:
 
Life Tap 11.6 22.43sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.59 0.00 0.00 0.00 1.1835 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 12.5 24.53sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.46 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.3 154.67sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.31 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.9 0.0 15.5sec 15.5sec 77.92% 77.92% 2.1(2.1) 19.1

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.16%
  • accelerando_2:23.59%
  • accelerando_3:14.46%
  • accelerando_4:6.91%
  • accelerando_5:3.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 23.0 25.5 13.2sec 0.0sec 56.04% 56.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:28.91%
  • active_uas_2:17.47%
  • active_uas_3:9.40%
  • active_uas_4:0.21%
  • active_uas_5:0.05%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 28.1 40.6 10.7sec 4.3sec 61.60% 100.00% 2.4(2.4) 1.4

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:25.63%
  • compounding_horror_2:16.86%
  • compounding_horror_3:9.98%
  • compounding_horror_4:5.18%
  • compounding_horror_5:3.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 12.5 0.0 24.7sec 24.7sec 75.23% 75.23% 0.0(0.0) 11.5

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:75.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.1sec 69.1sec 8.70% 8.70% 0.0(0.0) 3.2

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.4 0.0 69.5sec 68.6sec 13.50% 13.50% 0.0(0.0) 3.3

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 163.6sec 0.0sec 38.59% 38.59% 0.0(0.0) 1.9

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:38.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.3 0.0 153.8sec 153.8sec 12.95% 12.95% 0.0(0.0) 2.3

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:12.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 13.2 35.2 23.6sec 6.6sec 76.63% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:22.62%
  • tormented_souls_2:18.39%
  • tormented_souls_3:13.75%
  • tormented_souls_4:9.72%
  • tormented_souls_5:5.66%
  • tormented_souls_6:3.39%
  • tormented_souls_7:1.90%
  • tormented_souls_8:0.68%
  • tormented_souls_9:0.28%
  • tormented_souls_10:0.13%
  • tormented_souls_11:0.07%
  • tormented_souls_12:0.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 6.1 40.7sec
t18_2pc_affliction 48.5 6.2sec
soul_conduit 9.7 27.8sec
souls_consumed 46.6 24.7sec

Resources

Resource Usage Type Count Total Average RPE APR
Prydaz_Xavarics_Magnum_Opus
agony Mana 17.3 569917.8 33000.0 32999.6 71.5
corruption Mana 21.9 723915.7 33000.0 33000.1 49.1
drain_soul Mana 226.1 7462498.5 33000.0 112817.9 4.8
unstable_affliction Soul Shard 48.5 48.5 1.0 1.0 2670794.9
pet - doomguard
doom_bolt Energy 125.8 4402.3 35.0 35.0 5452.0
Resource Gains Type Count Total Average Overflow
life_tap Mana 11.59 3826166.30 (48.26%) 330000.00 0.00 0.00%
agony Soul Shard 36.05 36.05 (77.70%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.60 0.60 (1.29%) 1.00 0.00 0.00%
mp5_regen Mana 355.10 4102813.93 (51.74%) 11554.12 22064.33 0.53%
soul_conduit Soul Shard 9.75 9.75 (21.02%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 200.48 4361.26 (100.00%) 21.75 122.44 2.73%
Resource RPS-Gain RPS-Loss
Health 0.00 13255.67
Mana 26429.10 29186.71
Soul Shard 0.15 0.16
Combat End Resource Mean Min Max
Mana 269898.53 34423.71 494621.83
Soul Shard 0.88 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Prydaz_Xavarics_Magnum_Opus Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Prydaz_Xavarics_Magnum_Opus Damage Per Second
Count 4999
Mean 936111.17
Minimum 764242.41
Maximum 1141081.56
Spread ( max - min ) 376839.15
Range [ ( max - min ) / 2 * 100% ] 20.13%
Standard Deviation 51943.8399
5th Percentile 853492.82
95th Percentile 1024063.82
( 95th Percentile - 5th Percentile ) 170571.00
Mean Distribution
Standard Deviation 734.6703
95.00% Confidence Intervall ( 934671.24 - 937551.10 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 119
0.1% Error 11828
0.1 Scale Factor Error with Delta=300 23033068
0.05 Scale Factor Error with Delta=300 92132269
0.01 Scale Factor Error with Delta=300 2303306705
Priority Target DPS
Sample Data Prydaz_Xavarics_Magnum_Opus Priority Target Damage Per Second
Count 4999
Mean 936111.17
Minimum 764242.41
Maximum 1141081.56
Spread ( max - min ) 376839.15
Range [ ( max - min ) / 2 * 100% ] 20.13%
Standard Deviation 51943.8399
5th Percentile 853492.82
95th Percentile 1024063.82
( 95th Percentile - 5th Percentile ) 170571.00
Mean Distribution
Standard Deviation 734.6703
95.00% Confidence Intervall ( 934671.24 - 937551.10 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 119
0.1% Error 11828
0.1 Scale Factor Error with Delta=300 23033068
0.05 Scale Factor Error with Delta=300 92132269
0.01 Scale Factor Error with Delta=300 2303306705
DPS(e)
Sample Data Prydaz_Xavarics_Magnum_Opus Damage Per Second (Effective)
Count 4999
Mean 936111.17
Minimum 764242.41
Maximum 1141081.56
Spread ( max - min ) 376839.15
Range [ ( max - min ) / 2 * 100% ] 20.13%
Damage
Sample Data Prydaz_Xavarics_Magnum_Opus Damage
Count 4999
Mean 256464444.76
Minimum 176524585.08
Maximum 354898620.19
Spread ( max - min ) 178374035.11
Range [ ( max - min ) / 2 * 100% ] 34.78%
DTPS
Sample Data Prydaz_Xavarics_Magnum_Opus Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Prydaz_Xavarics_Magnum_Opus Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Prydaz_Xavarics_Magnum_Opus Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Prydaz_Xavarics_Magnum_Opus Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Prydaz_Xavarics_Magnum_Opus Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Prydaz_Xavarics_Magnum_Opus Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Prydaz_Xavarics_Magnum_OpusTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Prydaz_Xavarics_Magnum_Opus Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 1.51 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 4.24 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
D 2.31 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
E 0.97 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 0.73 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
G 13.03 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
H 10.97 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
I 14.83 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
J 6.38 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
K 5.99 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
L 1.76 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
M 40.94 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
N 8.75 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
O 2.19 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
P 0.62 life_tap,if=mana.pct<=10
Q 49.88 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACIMMMDNQIGMQMQIQGMMMNQJQMQQGHQIMMMNQGIMMQHQIQGMQIHQGMOQJQMMQHQGIMQMQIGMOQHQIQGMMQHQIMQGHQIMMNQQHQGIMMMDEQIQGMMMNQQHJMQCQIMMMNQQHGQIMQMQQIHGMMMNQKQFKQCQPKJQBQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Prydaz_Xavarics_Magnum_Opus 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Prydaz_Xavarics_Magnum_Opus 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Prydaz_Xavarics_Magnum_Opus 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.288 default I corruption Fluffy_Pillow 1088889.4/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:02.263 default M unstable_affliction Fluffy_Pillow 1072737.9/1100000: 98% mana | 3.0/5: 60% soul_shard bloodlust, accelerando(2), potion_of_prolonged_power
0:03.221 default M unstable_affliction Fluffy_Pillow 1089292.6/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, accelerando(2), potion_of_prolonged_power
0:04.182 default M unstable_affliction Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), accelerando(2), potion_of_prolonged_power
0:05.140 default D soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(3), accelerando(2), potion_of_prolonged_power
0:05.140 default N reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, active_uas(3), accelerando(2), potion_of_prolonged_power
0:05.140 default Q drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), accelerando(2), potion_of_prolonged_power
0:11.698 default I corruption Fluffy_Pillow 883384.1/1100000: 80% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, accelerando(3), potion_of_prolonged_power
0:12.642 default G agony Fluffy_Pillow 866416.4/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), potion_of_prolonged_power
0:13.634 default M unstable_affliction Fluffy_Pillow 849992.0/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), potion_of_prolonged_power
0:14.626 default Q drain_soul Fluffy_Pillow 866567.6/1100000: 79% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas, potion_of_prolonged_power
0:16.262 default M unstable_affliction Fluffy_Pillow 827903.9/1100000: 75% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), active_uas, potion_of_prolonged_power
0:17.255 default Q drain_soul Fluffy_Pillow 844496.2/1100000: 77% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), active_uas(2), potion_of_prolonged_power
0:25.940 default I corruption Fluffy_Pillow 564320.1/1100000: 51% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(3), compounding_horror(3), accelerando(2), potion_of_prolonged_power
0:26.898 default Q drain_soul Fluffy_Pillow 547874.8/1100000: 50% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(3), compounding_horror(3), accelerando(2), potion_of_prolonged_power
0:31.617 default G agony Fluffy_Pillow 397582.6/1100000: 36% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(3), compounding_horror(4), potion_of_prolonged_power
0:32.610 default M unstable_affliction Fluffy_Pillow 381174.9/1100000: 35% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(3), compounding_horror(5), potion_of_prolonged_power
0:33.601 default M unstable_affliction Fluffy_Pillow 397733.8/1100000: 36% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(3), active_uas, potion_of_prolonged_power
0:34.591 default M unstable_affliction Fluffy_Pillow 414276.0/1100000: 38% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(3), active_uas(2), potion_of_prolonged_power
0:35.584 default N reap_souls Fluffy_Pillow 430868.3/1100000: 39% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(3), active_uas(3), potion_of_prolonged_power
0:35.584 default Q drain_soul Fluffy_Pillow 430868.3/1100000: 39% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, active_uas(3), potion_of_prolonged_power
0:40.406 default J corruption Fluffy_Pillow 280440.4/1100000: 25% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls(2), compounding_horror(3), active_uas, potion_of_prolonged_power
0:41.397 default Q drain_soul Fluffy_Pillow 261873.9/1100000: 24% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(4), accelerando, potion_of_prolonged_power
0:43.358 default M unstable_affliction Fluffy_Pillow 221510.0/1100000: 20% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(4), accelerando, potion_of_prolonged_power
0:44.625 default Q drain_soul Fluffy_Pillow 238074.6/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(2), potion_of_prolonged_power
0:48.132 default Q drain_soul Fluffy_Pillow 152692.1/1100000: 14% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, accelerando(2), potion_of_prolonged_power
0:49.996 default G agony Fluffy_Pillow 111469.6/1100000: 10% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:51.242 default H life_tap Fluffy_Pillow 95032.3/1100000: 9% mana | 2.0/5: 40% soul_shard tormented_souls(3), compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:52.487 default Q drain_soul Fluffy_Pillow 441581.7/1100000: 40% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:54.490 default I corruption Fluffy_Pillow 401697.3/1100000: 37% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror(2), potion_of_prolonged_power
0:55.778 default M unstable_affliction Fluffy_Pillow 385252.3/1100000: 35% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror(2), potion_of_prolonged_power
0:57.065 default M unstable_affliction Fluffy_Pillow 401948.5/1100000: 37% mana | 2.0/5: 40% soul_shard tormented_souls(5), active_uas, accelerando, potion_of_prolonged_power
0:58.332 default M unstable_affliction Fluffy_Pillow 418512.0/1100000: 38% mana | 1.0/5: 20% soul_shard tormented_souls(6), active_uas(2), accelerando
0:59.599 default N reap_souls Fluffy_Pillow 435075.4/1100000: 40% mana | 0.0/5: 0% soul_shard tormented_souls(6), active_uas(3), accelerando
0:59.599 default Q drain_soul Fluffy_Pillow 435075.4/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), accelerando
1:07.442 default G agony Fluffy_Pillow 242930.7/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), accelerando(4)
1:08.647 default I corruption Fluffy_Pillow 226229.2/1100000: 21% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3)
1:09.935 default M unstable_affliction Fluffy_Pillow 209784.2/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3)
1:11.223 default M unstable_affliction Fluffy_Pillow 226340.3/1100000: 21% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas, accelerando
1:12.492 default Q drain_soul Fluffy_Pillow 242930.0/1100000: 22% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), accelerando
1:18.569 default H life_tap Fluffy_Pillow 91374.5/1100000: 8% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, active_uas, accelerando
1:19.837 default Q drain_soul Fluffy_Pillow 438229.0/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, accelerando(2)
1:21.730 default I corruption Fluffy_Pillow 397906.2/1100000: 36% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, accelerando(4)
1:22.934 default Q drain_soul Fluffy_Pillow 381439.6/1100000: 35% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), accelerando(4)
1:25.539 default G agony Fluffy_Pillow 316172.0/1100000: 29% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(2)
1:26.827 default M unstable_affliction Fluffy_Pillow 299727.0/1100000: 27% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(2)
1:28.115 default Q drain_soul Fluffy_Pillow 316547.7/1100000: 29% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(5), active_uas, accelerando
1:35.813 default I corruption Fluffy_Pillow 122494.0/1100000: 11% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror, accelerando(3)
1:37.040 default H life_tap Fluffy_Pillow 106073.7/1100000: 10% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror, accelerando(3)
1:38.266 default Q drain_soul Fluffy_Pillow 452639.9/1100000: 41% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror(2), accelerando(3)
1:44.224 default G agony Fluffy_Pillow 299056.4/1100000: 27% mana | 2.0/5: 40% soul_shard tormented_souls(6), compounding_horror(4), accelerando
1:45.489 default M unstable_affliction Fluffy_Pillow 282593.7/1100000: 26% mana | 2.0/5: 40% soul_shard tormented_souls(6), compounding_horror(4), accelerando
1:46.756 default O reap_souls Fluffy_Pillow 299158.3/1100000: 27% mana | 1.0/5: 20% soul_shard tormented_souls(6), active_uas, accelerando(2)
1:46.756 default Q drain_soul Fluffy_Pillow 299158.3/1100000: 27% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(2)
1:49.503 default J corruption Fluffy_Pillow 236673.3/1100000: 22% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(2)
1:50.748 default Q drain_soul Fluffy_Pillow 220222.7/1100000: 20% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(2)
1:52.580 default M unstable_affliction Fluffy_Pillow 178574.9/1100000: 16% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(2)
1:53.827 default M unstable_affliction Fluffy_Pillow 195150.9/1100000: 18% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(2)
1:55.073 default Q drain_soul Fluffy_Pillow 211389.7/1100000: 19% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2)
1:59.717 default H life_tap Fluffy_Pillow 107461.5/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), active_uas(2), accelerando(2)
2:00.965 default Q drain_soul Fluffy_Pillow 454050.7/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), active_uas, accelerando(2)
2:02.819 default G agony Fluffy_Pillow 412695.4/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(4), accelerando(2)
2:04.064 default I corruption Fluffy_Pillow 396244.8/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(5), accelerando(2)
2:05.311 default M unstable_affliction Fluffy_Pillow 379974.1/1100000: 35% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(5), accelerando(3)
2:06.537 default Q drain_soul Fluffy_Pillow 396600.5/1100000: 36% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), active_uas, accelerando(5)
2:09.153 default M unstable_affliction Fluffy_Pillow 331903.6/1100000: 30% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4)
2:10.442 default Q drain_soul Fluffy_Pillow 348471.5/1100000: 32% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), active_uas
2:17.472 default I corruption Fluffy_Pillow 175367.9/1100000: 16% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror, accelerando(2)
2:18.717 default G agony Fluffy_Pillow 158917.3/1100000: 14% mana | 1.0/5: 20% soul_shard tormented_souls(6), compounding_horror, accelerando(2)
2:19.964 default M unstable_affliction Fluffy_Pillow 142493.3/1100000: 13% mana | 1.0/5: 20% soul_shard tormented_souls(6), compounding_horror, accelerando(2)
2:21.209 default O reap_souls Fluffy_Pillow 159042.7/1100000: 14% mana | 0.0/5: 0% soul_shard tormented_souls(6), active_uas, accelerando(2)
2:21.209 default Q drain_soul Fluffy_Pillow 159042.7/1100000: 14% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando(2)
2:23.890 default H life_tap Fluffy_Pillow 95906.7/1100000: 9% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas, accelerando(3)
2:25.116 default Q drain_soul Fluffy_Pillow 442472.9/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), active_uas, accelerando(3)
2:31.945 default I corruption Fluffy_Pillow 268104.2/1100000: 24% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando
2:33.210 default Q drain_soul Fluffy_Pillow 251641.6/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(3), accelerando
2:37.475 default G agony Fluffy_Pillow 143747.7/1100000: 13% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), nefarious_pact, accelerando(3)
2:38.313 default M unstable_affliction Fluffy_Pillow 122113.5/1100000: 11% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), nefarious_pact, accelerando(4)
2:39.136 default M unstable_affliction Fluffy_Pillow 133415.1/1100000: 12% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas, nefarious_pact, accelerando(4)
2:39.961 default Q drain_soul Fluffy_Pillow 144744.0/1100000: 13% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), nefarious_pact, accelerando(4)
2:41.258 default H life_tap Fluffy_Pillow 96554.6/1100000: 9% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), nefarious_pact, accelerando(4)
2:42.083 default Q drain_soul Fluffy_Pillow 437883.6/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), nefarious_pact, accelerando(4)
2:46.161 default I corruption Fluffy_Pillow 259977.7/1100000: 24% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, nefarious_pact
2:47.041 default M unstable_affliction Fluffy_Pillow 238288.6/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, devils_due
2:48.568 default Q drain_soul Fluffy_Pillow 258236.5/1100000: 23% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas, devils_due, accelerando
2:56.820 default G agony Fluffy_Pillow 102897.6/1100000: 9% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror(2), nefarious_pact, accelerando(3)
2:57.656 default H life_tap Fluffy_Pillow 81194.0/1100000: 7% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror(2), nefarious_pact, accelerando(3)
2:58.494 default Q drain_soul Fluffy_Pillow 422517.4/1100000: 38% mana | 2.0/5: 40% soul_shard tormented_souls(5), compounding_horror(2), nefarious_pact, accelerando(3)
2:59.851 default I corruption Fluffy_Pillow 374417.6/1100000: 34% mana | 2.0/5: 40% soul_shard tormented_souls(5), nefarious_pact, accelerando
3:00.717 default M unstable_affliction Fluffy_Pillow 352883.6/1100000: 32% mana | 2.0/5: 40% soul_shard tormented_souls(5), nefarious_pact, accelerando(2)
3:01.568 default M unstable_affliction Fluffy_Pillow 364275.0/1100000: 33% mana | 1.0/5: 20% soul_shard tormented_souls(5), active_uas, nefarious_pact, accelerando(3)
3:02.405 default N reap_souls Fluffy_Pillow 375584.9/1100000: 34% mana | 0.0/5: 0% soul_shard tormented_souls(5), active_uas(2), nefarious_pact, accelerando(3)
3:02.405 default Q drain_soul Fluffy_Pillow 375584.9/1100000: 34% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), nefarious_pact, accelerando(3)
3:08.151 default Q drain_soul Fluffy_Pillow 124123.8/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), devils_due, accelerando(4)
3:10.343 default H life_tap Fluffy_Pillow 88224.5/1100000: 8% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(3), devils_due, accelerando(4)
3:11.774 default Q drain_soul Fluffy_Pillow 437755.2/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), devils_due, accelerando
3:13.999 default G agony Fluffy_Pillow 400917.5/1100000: 36% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), devils_due, accelerando(2)
3:15.478 default I corruption Fluffy_Pillow 387577.4/1100000: 35% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), accelerando(2)
3:16.723 default M unstable_affliction Fluffy_Pillow 371126.8/1100000: 34% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(5), accelerando(2)
3:17.970 default M unstable_affliction Fluffy_Pillow 387702.8/1100000: 35% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), active_uas, accelerando(2)
3:19.216 default M unstable_affliction Fluffy_Pillow 404265.5/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), accelerando(2)
3:20.461 default D soul_harvest Fluffy_Pillow 420814.9/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(3), accelerando(2)
3:20.461 default E potion Fluffy_Pillow 420814.9/1100000: 38% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), active_uas(3), accelerando(2)
3:20.461 default Q drain_soul Fluffy_Pillow 420814.9/1100000: 38% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), active_uas(3), accelerando(2), potion_of_prolonged_power
3:27.264 default I corruption Fluffy_Pillow 246421.0/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(4), compounding_horror(3), accelerando, potion_of_prolonged_power
3:28.531 default Q drain_soul Fluffy_Pillow 229984.5/1100000: 21% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(4), compounding_horror(4), accelerando, potion_of_prolonged_power
3:31.314 default G agony Fluffy_Pillow 167366.6/1100000: 15% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls(4), compounding_horror(5), accelerando, potion_of_prolonged_power
3:32.580 default M unstable_affliction Fluffy_Pillow 150917.0/1100000: 14% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls(4), compounding_horror(5), accelerando, potion_of_prolonged_power
3:33.847 default M unstable_affliction Fluffy_Pillow 167480.5/1100000: 15% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(4), active_uas, accelerando, potion_of_prolonged_power
3:35.114 default M unstable_affliction Fluffy_Pillow 184045.0/1100000: 17% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls(4), active_uas(2), accelerando(2), potion_of_prolonged_power
3:36.361 default N reap_souls Fluffy_Pillow 200361.3/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(4), active_uas(3), accelerando, potion_of_prolonged_power
3:36.361 default Q drain_soul Fluffy_Pillow 200361.3/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
3:39.114 default Q drain_soul Fluffy_Pillow 137351.3/1100000: 12% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), active_uas(3), accelerando, potion_of_prolonged_power
3:41.075 default H life_tap Fluffy_Pillow 96987.4/1100000: 9% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), active_uas(2), accelerando, potion_of_prolonged_power
3:42.342 default J corruption Fluffy_Pillow 443550.9/1100000: 40% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), active_uas, accelerando, potion_of_prolonged_power
3:43.608 default M unstable_affliction Fluffy_Pillow 427216.6/1100000: 39% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), accelerando(2), potion_of_prolonged_power
3:44.855 default Q drain_soul Fluffy_Pillow 443792.6/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(2), potion_of_prolonged_power
3:51.883 default C agony Fluffy_Pillow 272717.1/1100000: 25% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), accelerando, potion_of_prolonged_power
3:53.150 default Q drain_soul Fluffy_Pillow 256280.6/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), accelerando, potion_of_prolonged_power
3:55.983 default I corruption Fluffy_Pillow 194569.2/1100000: 18% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(2), accelerando(2), potion_of_prolonged_power
3:57.228 default M unstable_affliction Fluffy_Pillow 178118.6/1100000: 16% mana | 2.0/5: 40% soul_shard tormented_souls(5), compounding_horror(2), accelerando(2), potion_of_prolonged_power
3:58.473 default M unstable_affliction Fluffy_Pillow 194668.0/1100000: 18% mana | 1.0/5: 20% soul_shard tormented_souls(5), active_uas, accelerando(2), potion_of_prolonged_power
3:59.718 default M unstable_affliction Fluffy_Pillow 211218.3/1100000: 19% mana | 1.0/5: 20% soul_shard tormented_souls(5), active_uas(2), accelerando(3), potion_of_prolonged_power
4:00.943 default N reap_souls Fluffy_Pillow 227771.0/1100000: 21% mana | 0.0/5: 0% soul_shard tormented_souls(5), active_uas(3), accelerando(3), potion_of_prolonged_power
4:00.943 default Q drain_soul Fluffy_Pillow 227771.0/1100000: 21% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), accelerando(3), potion_of_prolonged_power
4:04.358 default Q drain_soul Fluffy_Pillow 140203.5/1100000: 13% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas(3), potion_of_prolonged_power
4:06.314 default H life_tap Fluffy_Pillow 99344.5/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), active_uas, potion_of_prolonged_power
4:07.603 default G agony Fluffy_Pillow 445912.4/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(3), potion_of_prolonged_power
4:08.892 default Q drain_soul Fluffy_Pillow 429480.2/1100000: 39% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), potion_of_prolonged_power
4:10.859 default I corruption Fluffy_Pillow 389194.8/1100000: 35% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando, potion_of_prolonged_power
4:12.126 default M unstable_affliction Fluffy_Pillow 372758.3/1100000: 34% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando, potion_of_prolonged_power
4:13.393 default Q drain_soul Fluffy_Pillow 389322.9/1100000: 35% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(2), potion_of_prolonged_power
4:17.797 default M unstable_affliction Fluffy_Pillow 283652.4/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), nefarious_pact, accelerando(3), potion_of_prolonged_power
4:18.634 default Q drain_soul Fluffy_Pillow 294962.3/1100000: 27% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas, nefarious_pact, accelerando(3), potion_of_prolonged_power
4:20.043 default Q drain_soul Fluffy_Pillow 248001.3/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), nefarious_pact, accelerando(3), potion_of_prolonged_power
4:23.100 default I corruption Fluffy_Pillow 123281.1/1100000: 11% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(2), nefarious_pact, accelerando
4:23.965 default H life_tap Fluffy_Pillow 101664.6/1100000: 9% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(2), nefarious_pact, accelerando(2)
4:24.816 default G agony Fluffy_Pillow 442976.7/1100000: 40% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(3), nefarious_pact, accelerando(2)
4:25.669 default M unstable_affliction Fluffy_Pillow 421315.3/1100000: 38% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(3), nefarious_pact, accelerando(2)
4:26.521 default M unstable_affliction Fluffy_Pillow 432640.7/1100000: 39% mana | 1.0/5: 20% soul_shard tormented_souls(5), active_uas, nefarious_pact, accelerando(2)
4:27.372 default M unstable_affliction Fluffy_Pillow 444027.7/1100000: 40% mana | 1.0/5: 20% soul_shard tormented_souls(5), active_uas(2), nefarious_pact, accelerando(3)
4:28.210 default N reap_souls Fluffy_Pillow 455351.1/1100000: 41% mana | 0.0/5: 0% soul_shard tormented_souls(5), active_uas(3), nefarious_pact, accelerando(3)
4:28.210 default Q drain_soul Fluffy_Pillow 455351.1/1100000: 41% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), nefarious_pact, accelerando(3)
4:30.636 default K unstable_affliction Fluffy_Pillow 356132.2/1100000: 32% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(3), devils_due, accelerando(3)
4:32.090 default Q drain_soul Fluffy_Pillow 376010.8/1100000: 34% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), devils_due, accelerando(4)
4:38.924 default F corruption Fluffy_Pillow 234869.2/1100000: 21% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando
4:40.191 default K unstable_affliction Fluffy_Pillow 218432.7/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando
4:41.459 default Q drain_soul Fluffy_Pillow 235009.2/1100000: 21% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando
4:45.916 default C agony Fluffy_Pillow 128275.5/1100000: 12% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando
4:47.183 default Q drain_soul Fluffy_Pillow 111576.0/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas
4:49.161 default P life_tap Fluffy_Pillow 71292.2/1100000: 6% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, accelerando
4:50.428 default K unstable_affliction Fluffy_Pillow 418050.6/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, accelerando(2)
4:51.674 default J corruption Fluffy_Pillow 434614.6/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(3)
4:52.900 default Q drain_soul Fluffy_Pillow 418185.6/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas, accelerando(4)
4:54.813 default B reap_souls Fluffy_Pillow 378455.2/1100000: 34% mana | 0.0/5: 0% soul_shard tormented_souls(3), compounding_horror(2), active_uas, accelerando(4)
4:54.813 default Q drain_soul Fluffy_Pillow 378455.2/1100000: 34% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), active_uas, accelerando(4)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 56169 56169 35271
Intellect 50513 48806 39155 (1278)
Spirit 0 0 0
Health 3370140 3370140 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50513 48806 0
Crit 21.02% 21.02% 6409
Haste 16.85% 16.85% 6318
Damage / Heal Versatility 2.33% 2.33% 1107
ManaReg per Second 12853 12853 0
Mastery 124.19% 121.19% 12313
Armor 1983 1983 1983
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 910.00
Local Head Eyes of Azj'Aqir
ilevel: 905, stats: { 257 Armor, +3410 Sta, +2273 Int, +1094 Haste, +589 Vers }
Local Neck Prydaz, Xavaric's Magnum Opus
ilevel: 940, stats: { +2658 Sta, +1495 Mastery, +1495 Crit, +1495 Haste }, gems: { +150 Mastery }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Master Warmage's Leggings
ilevel: 905, stats: { 277 Armor, +3410 Sta, +2273 Int, +914 Mastery, +769 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Bracers of Harnessed Flame
ilevel: 905, stats: { 139 Armor, +1918 Sta, +1278 Int, +595 Mastery, +351 Crit }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Spellblade's Gemmed Signet
ilevel: 905, stats: { +1918 Sta, +2073 Crit, +950 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Temporal Recalibration
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +636 Mastery, +311 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Prydaz_Xavarics_Magnum_Opus"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3518
neck=prydaz_xavarics_magnum_opus,id=132444,ilevel=940,gems=150mastery,enchant=mark_of_the_trained_soldier
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518
back=cloak_of_temporal_recalibration,id=140910,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3518
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518
legs=master_warmages_leggings,id=140852,bonus_id=3518
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=spellblades_gemmed_signet,id=140895,bonus_id=3518,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=erratic_metronome,id=140792,bonus_id=3445
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=909.60
# gear_stamina=35271
# gear_intellect=39155
# gear_crit_rating=6283
# gear_haste_rating=6194
# gear_mastery_rating=12072
# gear_versatility_rating=1085
# gear_armor=1983
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Reap_and_Sow : 941451 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
941451.1 941451.1 1352.9 / 0.144% 194065.0 / 20.6% 30.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
28272.9 28272.9 Mana 0.00% 31.5 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Reap_and_Sow 941451
Agony 138525 14.7% 17.3 18.09sec 2404064 1950882 Periodic 189.4 148112 392203 219220 29.1% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.27 0.00 189.44 189.44 1.2323 1.5792 41528419.81 41528419.81 0.00 129592.86 1950881.75
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 134.3 70.87% 148111.62 13355 236638 148127.23 129633 160638 19884562 19884562 0.00
crit 55.2 29.13% 392203.48 30983 624725 392226.97 321521 459554 21643858 21643858 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 7154 0.8% 26.5 11.10sec 80904 0 Direct 26.5 66403 133496 80905 21.6%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.52 26.52 0.00 0.00 0.0000 0.0000 2145332.70 2145332.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.79 78.39% 66402.94 19880 191461 66694.13 43009 102150 1380185 1380185 0.00
crit 5.73 21.61% 133496.12 39759 382921 133789.49 0 324509 765148 765148 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 120616 12.8% 21.9 13.85sec 1648370 1369281 Periodic 189.0 129308 341802 191272 29.2% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 0.00 189.04 189.04 1.2039 1.5755 36158615.50 36158615.50 0.00 111515.31 1369281.46
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.9 70.84% 129307.59 142 203163 129348.32 114954 139383 17316799 17316799 0.00
crit 55.1 29.16% 341801.83 367 536351 341890.77 274120 391976 18841817 18841817 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 119487 12.7% 64.0 4.63sec 559408 195589 Periodic 217.8 126939 254773 164427 29.3% 56.9%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.03 0.00 217.83 217.83 2.8601 0.7842 35816204.96 35816204.96 0.00 195588.71 195588.71
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.9 70.68% 126938.83 79023 160829 126998.45 115286 133638 19542233 19542233 0.00
crit 63.9 29.32% 254772.82 158046 321659 254861.67 232368 273500 16273972 16273972 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 26316 2.8% 53.6 5.48sec 147295 0 Direct 53.3 121538 243160 147930 21.7%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.57 53.35 0.00 0.00 0.0000 0.0000 7891280.77 7891280.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.77 78.30% 121538.15 80762 155564 121553.05 109673 132012 5076612 5076612 0.00
crit 11.58 21.70% 243160.47 161524 311128 243135.59 194653 289615 2814669 2814669 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Soul 19633 2.1% 16.8 16.81sec 349568 0 Direct 16.8 287113 574986 349565 21.7%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.82 16.82 0.00 0.00 0.0000 0.0000 5880844.49 5880844.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.17 78.31% 287113.26 186372 358988 287106.98 235900 335981 3782435 3782435 0.00
crit 3.65 21.69% 574986.40 372743 717977 557713.77 0 717977 2098409 2098409 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (429835) 0.0% (45.6%) 46.9 6.39sec 2748325 2314992

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.86 0.00 0.00 0.00 1.1872 0.0000 0.00 0.00 0.00 2314992.44 2314992.44
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 192120 20.4% 0.0 0.00sec 0 0 Periodic 108.6 316379 839223 530428 40.9% 51.0%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 108.59 108.59 0.0000 1.4076 57603554.65 57603554.65 0.00 376848.50 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.1 59.06% 316379.24 604 479608 316830.32 268867 369360 20290404 20290404 0.00
crit 44.5 40.94% 839223.11 523 1266165 840157.04 672626 995696 37313151 37313151 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 148806 15.8% 0.0 0.00sec 0 0 Periodic 79.9 332420 879288 557786 41.2% 37.1%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 79.94 79.94 0.0000 1.3913 44590365.50 44590365.50 0.00 400916.78 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.0 58.79% 332420.01 430 479608 333179.05 263327 389540 15623227 15623227 0.00
crit 32.9 41.21% 879288.20 1136 1266165 881621.60 687665 1080785 28967138 28967138 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 82378 8.7% 0.0 0.00sec 0 0 Periodic 42.8 341466 904730 574909 41.4% 19.3%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 42.84 42.84 0.0000 1.3544 24632305.32 24632305.32 0.00 424489.99 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.1 58.55% 341466.30 1168 479608 345011.97 246518 479608 8566637 8566637 0.00
crit 17.8 41.45% 904730.21 668 1266165 912972.70 0 1266165 16065668 16065668 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 5656 0.6% 0.0 0.00sec 0 0 Periodic 3.2 316448 842328 532795 41.1% 1.5%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 3.17 3.17 0.0000 1.3987 1687114.56 1687114.56 0.00 381010.52 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.9 58.86% 316448.09 1657 479608 149976.72 0 479608 589731 589731 0.00
crit 1.3 41.14% 842327.61 5003 1266165 377017.55 0 1266165 1097384 1097384 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 874 0.1% 0.0 0.00sec 0 0 Periodic 0.5 306109 797538 503631 40.2% 0.2%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.52 0.52 0.0000 1.4200 260429.18 260429.18 0.00 354808.15 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 59.81% 306108.61 2280 479608 30535.28 0 479608 94668 94668 0.00
crit 0.2 40.19% 797537.62 5060 1266165 72640.64 0 1266165 165761 165761 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 79886 / 79886
Doom Bolt 79886 8.5% 121.8 2.45sec 196680 82204 Direct 121.0 162816 325460 197950 21.6%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.78 120.99 0.00 0.00 2.3926 0.0000 23950723.23 23950723.23 0.00 82203.76 82203.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 94.85 78.40% 162815.91 132693 229607 162846.45 155364 168495 15443697 15443697 0.00
crit 26.14 21.60% 325460.09 265385 459214 325512.26 298027 362814 8507026 8507026 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Reap_and_Sow
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Reap_and_Sow
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Reap_and_Sow
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Reap_and_Sow
  • harmful:false
  • if_expr:
 
Life Tap 11.2 23.11sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.16 0.00 0.00 0.00 1.2238 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 8.0 38.36sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.3 155.92sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.28 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.9 0.0 15.5sec 15.5sec 77.99% 77.99% 2.1(2.1) 19.1

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.13%
  • accelerando_2:23.69%
  • accelerando_3:14.40%
  • accelerando_4:6.94%
  • accelerando_5:3.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 22.5 24.3 13.5sec 0.0sec 56.01% 56.01% 0.0(0.0) 0.0

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:29.34%
  • active_uas_2:17.25%
  • active_uas_3:9.16%
  • active_uas_4:0.21%
  • active_uas_5:0.05%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 28.4 43.2 10.5sec 4.1sec 63.02% 100.00% 3.0(3.0) 1.3

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:25.55%
  • compounding_horror_2:17.00%
  • compounding_horror_3:10.29%
  • compounding_horror_4:5.59%
  • compounding_horror_5:4.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 8.0 0.0 38.3sec 38.3sec 88.72% 88.72% 0.0(0.0) 7.1

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:88.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 69.9sec 69.9sec 8.72% 8.72% 0.0(0.0) 3.2

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.5 0.0 70.2sec 69.4sec 13.56% 13.56% 0.0(0.0) 3.3

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.56%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 166.9sec 0.0sec 38.25% 38.25% 0.0(0.0) 1.9

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:38.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.3 0.0 156.3sec 156.3sec 12.78% 12.78% 0.0(0.0) 2.2

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:12.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 8.9 39.7 34.8sec 6.5sec 84.57% 100.00% 0.5(0.5) 0.0

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:15.87%
  • tormented_souls_2:15.08%
  • tormented_souls_3:13.62%
  • tormented_souls_4:11.92%
  • tormented_souls_5:8.84%
  • tormented_souls_6:6.66%
  • tormented_souls_7:4.89%
  • tormented_souls_8:2.89%
  • tormented_souls_9:1.81%
  • tormented_souls_10:1.18%
  • tormented_souls_11:0.74%
  • tormented_souls_12:1.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 6.1 40.4sec
t18_2pc_affliction 46.9 6.4sec
soul_conduit 9.3 28.7sec
souls_consumed 44.5 38.3sec

Resources

Resource Usage Type Count Total Average RPE APR
Reap_and_Sow
agony Mana 17.3 570043.2 33000.0 32999.6 72.9
corruption Mana 21.9 723889.3 33000.0 33000.1 50.0
drain_soul Mana 217.8 7188136.1 33000.0 112270.4 5.0
unstable_affliction Soul Shard 46.9 46.9 1.0 1.0 2748317.8
pet - doomguard
doom_bolt Energy 121.8 4262.1 35.0 35.0 5619.4
Resource Gains Type Count Total Average Overflow
life_tap Mana 11.16 3683032.18 (48.12%) 330000.00 0.00 0.00%
agony Soul Shard 34.84 34.84 (77.88%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.59 0.59 (1.32%) 1.00 0.00 0.00%
mp5_regen Mana 351.33 3970417.55 (51.88%) 11300.96 21800.21 0.55%
soul_conduit Soul Shard 9.30 9.30 (20.80%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 195.80 4220.60 (100.00%) 21.56 118.12 2.72%
Resource RPS-Gain RPS-Loss
Health 0.00 12752.82
Mana 25510.98 28272.94
Soul Shard 0.15 0.16
Combat End Resource Mean Min Max
Mana 274614.82 34683.52 484698.25
Soul Shard 0.89 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Reap_and_Sow Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Reap_and_Sow Damage Per Second
Count 4999
Mean 941451.09
Minimum 764359.94
Maximum 1157671.58
Spread ( max - min ) 393311.64
Range [ ( max - min ) / 2 * 100% ] 20.89%
Standard Deviation 48805.2833
5th Percentile 864559.06
95th Percentile 1024399.06
( 95th Percentile - 5th Percentile ) 159840.00
Mean Distribution
Standard Deviation 690.2800
95.00% Confidence Intervall ( 940098.17 - 942804.01 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 104
0.1% Error 10324
0.1 Scale Factor Error with Delta=300 20333744
0.05 Scale Factor Error with Delta=300 81334975
0.01 Scale Factor Error with Delta=300 2033374373
Priority Target DPS
Sample Data Reap_and_Sow Priority Target Damage Per Second
Count 4999
Mean 941451.09
Minimum 764359.94
Maximum 1157671.58
Spread ( max - min ) 393311.64
Range [ ( max - min ) / 2 * 100% ] 20.89%
Standard Deviation 48805.2833
5th Percentile 864559.06
95th Percentile 1024399.06
( 95th Percentile - 5th Percentile ) 159840.00
Mean Distribution
Standard Deviation 690.2800
95.00% Confidence Intervall ( 940098.17 - 942804.01 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 104
0.1% Error 10324
0.1 Scale Factor Error with Delta=300 20333744
0.05 Scale Factor Error with Delta=300 81334975
0.01 Scale Factor Error with Delta=300 2033374373
DPS(e)
Sample Data Reap_and_Sow Damage Per Second (Effective)
Count 4999
Mean 941451.09
Minimum 764359.94
Maximum 1157671.58
Spread ( max - min ) 393311.64
Range [ ( max - min ) / 2 * 100% ] 20.89%
Damage
Sample Data Reap_and_Sow Damage
Count 4999
Mean 258194467.44
Minimum 183154968.16
Maximum 345768756.79
Spread ( max - min ) 162613788.63
Range [ ( max - min ) / 2 * 100% ] 31.49%
DTPS
Sample Data Reap_and_Sow Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Reap_and_Sow Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Reap_and_Sow Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Reap_and_Sow Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Reap_and_Sow Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Reap_and_Sow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Reap_and_SowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Reap_and_Sow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 2.26 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 4.49 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
D 2.28 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
E 0.96 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 0.87 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
G 12.78 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
H 10.56 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
I 14.46 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
J 6.61 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
K 5.73 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
L 1.58 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
M 39.72 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
N 4.73 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
O 1.06 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
P 0.61 life_tap,if=mana.pct<=10
Q 48.59 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACIMMMDNQIQGMMMQIQQGMMMBQIQQHQGQILMMQGIMMQHQMQJQBGMQHIQGMQJQMMQQHQCIMMQIGMQHQMQBJQGMMQQHIMMQGQIMMMDEQHQGIMMQIQGHMMMQJQGBMQHJMQMQGQIHMMMQIGMQQHKQJKKKQCQKJQKKQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Reap_and_Sow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Reap_and_Sow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Reap_and_Sow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.332 default I corruption Fluffy_Pillow 1088901.2/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:02.340 default M unstable_affliction Fluffy_Pillow 1072763.0/1100000: 98% mana | 3.0/5: 60% soul_shard bloodlust, accelerando(2), potion_of_prolonged_power
0:03.331 default M unstable_affliction Fluffy_Pillow 1089340.4/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, accelerando(2), potion_of_prolonged_power
0:04.323 default M unstable_affliction Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), accelerando(2), potion_of_prolonged_power
0:05.313 default D soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(3), accelerando(2), potion_of_prolonged_power
0:05.313 default N reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, active_uas(3), accelerando(2), potion_of_prolonged_power
0:05.313 default Q drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), accelerando(2), potion_of_prolonged_power
0:11.530 default I corruption Fluffy_Pillow 906997.7/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, accelerando(2), potion_of_prolonged_power
0:12.520 default Q drain_soul Fluffy_Pillow 890261.1/1100000: 81% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, potion_of_prolonged_power
0:14.082 default G agony Fluffy_Pillow 849497.3/1100000: 77% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror, potion_of_prolonged_power
0:15.108 default M unstable_affliction Fluffy_Pillow 833233.0/1100000: 76% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror(2), accelerando, potion_of_prolonged_power
0:16.116 default M unstable_affliction Fluffy_Pillow 849806.8/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), active_uas, accelerando, potion_of_prolonged_power
0:17.123 default M unstable_affliction Fluffy_Pillow 866364.3/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), active_uas(2), accelerando, potion_of_prolonged_power
0:18.132 default Q drain_soul Fluffy_Pillow 882954.6/1100000: 80% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(2), active_uas(3), accelerando, potion_of_prolonged_power
0:25.575 default I corruption Fluffy_Pillow 644273.6/1100000: 59% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(6), compounding_horror(2), nefarious_pact, accelerando(2), potion_of_prolonged_power
0:26.329 default Q drain_soul Fluffy_Pillow 623886.5/1100000: 57% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(6), compounding_horror(2), nefarious_pact, accelerando(2), potion_of_prolonged_power
0:27.512 default Q drain_soul Fluffy_Pillow 577126.3/1100000: 52% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(6), compounding_horror(2), nefarious_pact, potion_of_prolonged_power
0:31.001 default G agony Fluffy_Pillow 402854.7/1100000: 37% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls(7), compounding_horror(3), nefarious_pact, accelerando, potion_of_prolonged_power
0:31.756 default M unstable_affliction Fluffy_Pillow 382268.7/1100000: 35% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls(7), compounding_horror(3), nefarious_pact, accelerando, potion_of_prolonged_power
0:32.510 default M unstable_affliction Fluffy_Pillow 394685.9/1100000: 36% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls(7), active_uas, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:33.265 default M unstable_affliction Fluffy_Pillow 407338.9/1100000: 37% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(8), active_uas(2), nefarious_pact, accelerando(3), potion_of_prolonged_power
0:34.020 default B reap_souls Fluffy_Pillow 420184.2/1100000: 38% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(8), active_uas(3), nefarious_pact, accelerando(3), potion_of_prolonged_power
0:34.020 default Q drain_soul Fluffy_Pillow 420184.2/1100000: 38% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, active_uas(3), nefarious_pact, accelerando(3), potion_of_prolonged_power
0:40.028 default I corruption Fluffy_Pillow 193472.5/1100000: 18% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls, devils_due, accelerando(5), potion_of_prolonged_power
0:41.145 default Q drain_soul Fluffy_Pillow 177890.9/1100000: 16% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, devils_due, accelerando(5), potion_of_prolonged_power
0:44.178 default Q drain_soul Fluffy_Pillow 117245.2/1100000: 11% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), potion_of_prolonged_power
0:46.223 default H life_tap Fluffy_Pillow 76660.4/1100000: 7% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), potion_of_prolonged_power
0:47.554 default Q drain_soul Fluffy_Pillow 423202.0/1100000: 38% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), potion_of_prolonged_power
0:49.640 default G agony Fluffy_Pillow 383126.7/1100000: 35% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), potion_of_prolonged_power
0:50.971 default Q drain_soul Fluffy_Pillow 366668.3/1100000: 33% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), potion_of_prolonged_power
0:53.896 default I corruption Fluffy_Pillow 304722.9/1100000: 28% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), accelerando(2), potion_of_prolonged_power
0:55.181 default L unstable_affliction Fluffy_Pillow 288257.8/1100000: 26% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), accelerando(2), potion_of_prolonged_power
0:56.467 default M unstable_affliction Fluffy_Pillow 304805.6/1100000: 28% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(3), active_uas, accelerando(2), potion_of_prolonged_power
0:57.753 default M unstable_affliction Fluffy_Pillow 321353.4/1100000: 29% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), active_uas(2), accelerando(2), potion_of_prolonged_power
0:59.040 default Q drain_soul Fluffy_Pillow 337914.1/1100000: 31% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), active_uas(3), accelerando(2)
1:07.076 default G agony Fluffy_Pillow 143856.3/1100000: 13% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(7), compounding_horror, accelerando
1:08.386 default I corruption Fluffy_Pillow 127425.1/1100000: 12% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(7), compounding_horror, accelerando
1:09.693 default M unstable_affliction Fluffy_Pillow 111243.2/1100000: 10% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(7), compounding_horror, accelerando(2)
1:10.980 default M unstable_affliction Fluffy_Pillow 127978.5/1100000: 12% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(8), active_uas, accelerando(3)
1:12.245 default Q drain_soul Fluffy_Pillow 144534.0/1100000: 13% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(8), active_uas(2), accelerando(3)
1:14.128 default H life_tap Fluffy_Pillow 103177.5/1100000: 9% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(9), active_uas(2), accelerando(3)
1:15.391 default Q drain_soul Fluffy_Pillow 449706.8/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(9), active_uas(2), accelerando(3)
1:17.407 default M unstable_affliction Fluffy_Pillow 409821.3/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(9), compounding_horror, active_uas(2)
1:18.739 default Q drain_soul Fluffy_Pillow 426408.1/1100000: 39% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(9), active_uas(2), accelerando
1:21.490 default J corruption Fluffy_Pillow 362456.5/1100000: 33% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(9), compounding_horror, active_uas, accelerando(2)
1:22.776 default Q drain_soul Fluffy_Pillow 346004.3/1100000: 31% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(9), compounding_horror(2), active_uas, accelerando(2)
1:26.432 default B reap_souls Fluffy_Pillow 262065.5/1100000: 24% mana | 1.0/5: 20% soul_shard tormented_souls(10), compounding_horror(2), accelerando(4)
1:26.432 default G agony Fluffy_Pillow 262065.5/1100000: 24% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), accelerando(4)
1:27.675 default M unstable_affliction Fluffy_Pillow 245606.2/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(4), accelerando(4)
1:28.917 default Q drain_soul Fluffy_Pillow 262133.6/1100000: 24% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando(4)
1:35.074 default H life_tap Fluffy_Pillow 109123.2/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, active_uas
1:36.407 default I corruption Fluffy_Pillow 455883.5/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), accelerando
1:37.716 default Q drain_soul Fluffy_Pillow 439439.6/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), accelerando
1:44.030 default G agony Fluffy_Pillow 289218.0/1100000: 26% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), accelerando(4)
1:45.274 default M unstable_affliction Fluffy_Pillow 272772.0/1100000: 25% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), accelerando(4)
1:46.518 default Q drain_soul Fluffy_Pillow 289454.5/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(5)
1:50.045 default J corruption Fluffy_Pillow 202634.9/1100000: 18% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas, accelerando
1:51.356 default Q drain_soul Fluffy_Pillow 186216.3/1100000: 17% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), active_uas, accelerando
1:53.388 default M unstable_affliction Fluffy_Pillow 145917.0/1100000: 13% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), accelerando
1:54.697 default M unstable_affliction Fluffy_Pillow 162501.0/1100000: 15% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), active_uas, accelerando(2)
1:55.981 default Q drain_soul Fluffy_Pillow 179023.5/1100000: 16% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), active_uas(2), accelerando(3)
1:58.676 default Q drain_soul Fluffy_Pillow 115294.0/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(2), active_uas(2), accelerando(3)
2:00.630 default H life_tap Fluffy_Pillow 74866.7/1100000: 7% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(3), active_uas(2), accelerando(3)
2:01.894 default Q drain_soul Fluffy_Pillow 420791.2/1100000: 38% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(5), compounding_horror(4), active_uas
2:03.857 default C agony Fluffy_Pillow 379187.3/1100000: 34% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(6), compounding_horror(4)
2:05.190 default I corruption Fluffy_Pillow 362825.2/1100000: 33% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(8), compounding_horror(4), accelerando
2:06.498 default M unstable_affliction Fluffy_Pillow 346368.8/1100000: 31% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(9), compounding_horror(4), accelerando
2:07.808 default M unstable_affliction Fluffy_Pillow 362937.6/1100000: 33% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(9), active_uas, accelerando
2:09.117 default Q drain_soul Fluffy_Pillow 379493.7/1100000: 34% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(9), active_uas(2), accelerando
2:18.002 default I corruption Fluffy_Pillow 163266.7/1100000: 15% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(11), compounding_horror(2), accelerando
2:19.312 default G agony Fluffy_Pillow 146835.6/1100000: 13% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(11), compounding_horror(3), accelerando
2:20.621 default M unstable_affliction Fluffy_Pillow 130428.2/1100000: 12% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(11), compounding_horror(3), accelerando(2)
2:21.908 default Q drain_soul Fluffy_Pillow 146988.9/1100000: 13% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(11), active_uas, accelerando(2)
2:23.934 default H life_tap Fluffy_Pillow 107058.7/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(12), compounding_horror, active_uas, accelerando(2)
2:25.221 default Q drain_soul Fluffy_Pillow 453619.4/1100000: 41% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(12), compounding_horror, active_uas, accelerando(2)
2:27.206 default M unstable_affliction Fluffy_Pillow 413658.7/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(12), compounding_horror(3), active_uas, accelerando(4)
2:28.450 default Q drain_soul Fluffy_Pillow 430212.7/1100000: 39% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(12), active_uas(2), accelerando(4)
2:31.987 default B reap_souls Fluffy_Pillow 342559.7/1100000: 31% mana | 0.0/5: 0% soul_shard tormented_souls(12), compounding_horror, active_uas
2:31.987 default J corruption Fluffy_Pillow 342559.7/1100000: 31% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas
2:33.318 default Q drain_soul Fluffy_Pillow 326101.3/1100000: 30% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas
2:37.069 default G agony Fluffy_Pillow 240765.0/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), accelerando
2:38.376 default M unstable_affliction Fluffy_Pillow 224295.9/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), nefarious_pact, accelerando
2:39.272 default M unstable_affliction Fluffy_Pillow 235697.6/1100000: 21% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, nefarious_pact, accelerando(2)
2:40.150 default Q drain_soul Fluffy_Pillow 246995.4/1100000: 22% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), nefarious_pact, accelerando(2)
2:43.301 default Q drain_soul Fluffy_Pillow 122541.4/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas(2), nefarious_pact, accelerando(2)
2:44.712 default H life_tap Fluffy_Pillow 74697.7/1100000: 7% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, nefarious_pact, accelerando(2)
2:45.593 default I corruption Fluffy_Pillow 416034.1/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, nefarious_pact, accelerando(2)
2:46.472 default M unstable_affliction Fluffy_Pillow 394537.9/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, nefarious_pact, accelerando(3)
2:47.339 default M unstable_affliction Fluffy_Pillow 405884.6/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas, nefarious_pact, accelerando(3)
2:48.203 default Q drain_soul Fluffy_Pillow 417192.1/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), nefarious_pact, accelerando(3)
2:55.009 default G agony Fluffy_Pillow 205256.8/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), devils_due, accelerando
2:56.563 default Q drain_soul Fluffy_Pillow 191911.7/1100000: 17% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), devils_due, accelerando
2:59.940 default I corruption Fluffy_Pillow 135623.8/1100000: 12% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(5), accelerando
3:01.248 default M unstable_affliction Fluffy_Pillow 119167.3/1100000: 11% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(5), accelerando
3:02.555 default M unstable_affliction Fluffy_Pillow 135698.2/1100000: 12% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(6), active_uas, accelerando
3:03.864 default M unstable_affliction Fluffy_Pillow 152254.3/1100000: 14% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(7), active_uas(2), accelerando
3:05.172 default D soul_harvest Fluffy_Pillow 168797.9/1100000: 15% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(7), active_uas(3), accelerando
3:05.172 default E potion Fluffy_Pillow 168797.9/1100000: 15% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(7), active_uas(3), accelerando
3:05.172 default Q drain_soul Fluffy_Pillow 168797.9/1100000: 15% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(7), active_uas(3), accelerando, potion_of_prolonged_power
3:07.979 default H life_tap Fluffy_Pillow 105180.3/1100000: 10% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(8), active_uas(3), accelerando, potion_of_prolonged_power
3:09.288 default Q drain_soul Fluffy_Pillow 451736.5/1100000: 41% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(8), compounding_horror, active_uas(3), accelerando, potion_of_prolonged_power
3:12.985 default G agony Fluffy_Pillow 367060.3/1100000: 33% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls(9), compounding_horror(2), accelerando(2), potion_of_prolonged_power
3:14.272 default I corruption Fluffy_Pillow 350811.5/1100000: 32% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls(9), compounding_horror(2), accelerando(3), potion_of_prolonged_power
3:15.539 default M unstable_affliction Fluffy_Pillow 334393.2/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls(10), compounding_horror(3), accelerando(3), potion_of_prolonged_power
3:16.804 default M unstable_affliction Fluffy_Pillow 350948.7/1100000: 32% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(10), active_uas, accelerando(3), potion_of_prolonged_power
3:18.068 default Q drain_soul Fluffy_Pillow 367491.1/1100000: 33% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(10), active_uas(2), accelerando(3), potion_of_prolonged_power
3:27.656 default I corruption Fluffy_Pillow 128471.7/1100000: 12% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(12), compounding_horror, accelerando(4), potion_of_prolonged_power
3:28.898 default Q drain_soul Fluffy_Pillow 111999.1/1100000: 10% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(12), compounding_horror, accelerando(4), potion_of_prolonged_power
3:30.911 default G agony Fluffy_Pillow 72786.2/1100000: 7% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(12), compounding_horror, accelerando(4), potion_of_prolonged_power
3:32.155 default H life_tap Fluffy_Pillow 56362.4/1100000: 5% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(12), compounding_horror, potion_of_prolonged_power
3:33.486 default M unstable_affliction Fluffy_Pillow 402904.0/1100000: 37% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(12), compounding_horror, potion_of_prolonged_power
3:34.817 default M unstable_affliction Fluffy_Pillow 419445.6/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(12), active_uas, potion_of_prolonged_power
3:36.150 default M unstable_affliction Fluffy_Pillow 436012.0/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(12), active_uas(2), potion_of_prolonged_power
3:37.481 default Q drain_soul Fluffy_Pillow 452553.6/1100000: 41% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(12), active_uas(3), potion_of_prolonged_power
3:42.174 default J corruption Fluffy_Pillow 345878.0/1100000: 31% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(12), compounding_horror(2), active_uas(2), potion_of_prolonged_power
3:43.506 default Q drain_soul Fluffy_Pillow 329590.2/1100000: 30% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(12), compounding_horror(2), active_uas, accelerando, potion_of_prolonged_power
3:49.921 default G agony Fluffy_Pillow 179726.7/1100000: 16% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(12), compounding_horror(4), accelerando, potion_of_prolonged_power
3:51.229 default B reap_souls Fluffy_Pillow 163270.3/1100000: 15% mana | 2.0/5: 40% soul_shard tormented_souls(12), compounding_horror(4), accelerando, potion_of_prolonged_power
3:51.229 default M unstable_affliction Fluffy_Pillow 163270.3/1100000: 15% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(4), accelerando, potion_of_prolonged_power
3:52.537 default Q drain_soul Fluffy_Pillow 179814.6/1100000: 16% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(2), potion_of_prolonged_power
3:56.180 default H life_tap Fluffy_Pillow 94385.7/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, nefarious_pact, potion_of_prolonged_power
3:57.091 default J corruption Fluffy_Pillow 435707.6/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, nefarious_pact, potion_of_prolonged_power
3:58.000 default M unstable_affliction Fluffy_Pillow 414004.6/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, nefarious_pact, potion_of_prolonged_power
3:58.910 default Q drain_soul Fluffy_Pillow 425314.0/1100000: 39% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), nefarious_pact, potion_of_prolonged_power
4:01.025 default M unstable_affliction Fluffy_Pillow 352599.1/1100000: 32% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas, nefarious_pact, potion_of_prolonged_power
4:01.936 default Q drain_soul Fluffy_Pillow 364056.0/1100000: 33% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), nefarious_pact, accelerando, potion_of_prolonged_power
4:06.993 default G agony Fluffy_Pillow 164016.7/1100000: 15% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, devils_due, accelerando
4:08.545 default Q drain_soul Fluffy_Pillow 150646.3/1100000: 14% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, devils_due, accelerando
4:10.933 default I corruption Fluffy_Pillow 115147.5/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), devils_due, accelerando(2)
4:12.459 default H life_tap Fluffy_Pillow 101783.6/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), devils_due, accelerando(2)
4:13.985 default M unstable_affliction Fluffy_Pillow 451264.3/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), devils_due
4:15.565 default M unstable_affliction Fluffy_Pillow 470900.5/1100000: 43% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas, nefarious_pact
4:16.477 default M unstable_affliction Fluffy_Pillow 482234.8/1100000: 44% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), nefarious_pact
4:17.387 default Q drain_soul Fluffy_Pillow 493544.2/1100000: 45% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(3), nefarious_pact
4:23.732 default I corruption Fluffy_Pillow 243585.3/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(4), nefarious_pact, accelerando
4:24.625 default G agony Fluffy_Pillow 221879.9/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(4), nefarious_pact, accelerando
4:25.520 default M unstable_affliction Fluffy_Pillow 200199.8/1100000: 18% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(4), nefarious_pact, accelerando
4:26.414 default Q drain_soul Fluffy_Pillow 211507.1/1100000: 19% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), active_uas, nefarious_pact, accelerando
4:29.043 default Q drain_soul Fluffy_Pillow 112758.6/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(5), active_uas, devils_due, accelerando
4:31.358 default H life_tap Fluffy_Pillow 75870.3/1100000: 7% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), devils_due, accelerando
4:32.911 default K unstable_affliction Fluffy_Pillow 425512.5/1100000: 39% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), devils_due, accelerando
4:34.462 default Q drain_soul Fluffy_Pillow 445366.3/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(5), active_uas, devils_due, accelerando(2)
4:37.693 default J corruption Fluffy_Pillow 387941.7/1100000: 35% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(6), active_uas, accelerando(2)
4:38.980 default K unstable_affliction Fluffy_Pillow 371502.4/1100000: 34% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(8), active_uas, accelerando(2)
4:40.265 default K unstable_affliction Fluffy_Pillow 388037.3/1100000: 35% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(8), active_uas(2), accelerando(2)
4:41.551 default K unstable_affliction Fluffy_Pillow 404586.0/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(8), active_uas(3), accelerando(3)
4:42.816 default Q drain_soul Fluffy_Pillow 421194.5/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(8), active_uas(3), accelerando(4)
4:45.590 default C agony Fluffy_Pillow 357173.1/1100000: 32% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(8), active_uas(3), accelerando
4:46.898 default Q drain_soul Fluffy_Pillow 340716.6/1100000: 31% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(8), active_uas(3), accelerando
4:50.682 default K unstable_affliction Fluffy_Pillow 256576.5/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(9), compounding_horror, accelerando
4:51.990 default J corruption Fluffy_Pillow 273120.0/1100000: 25% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(9), active_uas, accelerando
4:53.298 default Q drain_soul Fluffy_Pillow 256663.5/1100000: 23% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(9), active_uas, accelerando
4:55.318 default K unstable_affliction Fluffy_Pillow 216765.1/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(10), active_uas, accelerando(3)
4:56.585 default K unstable_affliction Fluffy_Pillow 233486.7/1100000: 21% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(10), active_uas(2)
4:57.917 default Q drain_soul Fluffy_Pillow 250041.9/1100000: 23% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(10), active_uas(3), accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 56169 56169 35271
Intellect 51031 49325 39649
Spirit 0 0 0
Health 3370140 3370140 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 51031 49325 0
Crit 21.61% 21.61% 6645
Haste 12.98% 12.98% 4868
Damage / Heal Versatility 2.33% 2.33% 1107
ManaReg per Second 12428 12428 0
Mastery 121.87% 118.87% 12016
Armor 2004 2004 2004
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 910.00
Local Head Eyes of Azj'Aqir
ilevel: 905, stats: { 257 Armor, +3410 Sta, +2273 Int, +1094 Haste, +589 Vers }
Local Neck Beleron's Choker of Misery
ilevel: 905, stats: { +1918 Sta, +1727 Crit, +1295 Mastery }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Master Warmage's Leggings
ilevel: 905, stats: { 277 Armor, +3410 Sta, +2273 Int, +914 Mastery, +769 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Bracers of Harnessed Flame
ilevel: 905, stats: { 139 Armor, +1918 Sta, +1278 Int, +595 Mastery, +351 Crit }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Spellblade's Gemmed Signet
ilevel: 905, stats: { +1918 Sta, +2073 Crit, +950 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Reap and Sow
ilevel: 940, stats: { 179 Armor, +2658 Sta, +1772 Int, +694 Mastery, +385 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Reap_and_Sow"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3518
neck=belerons_choker_of_misery,id=140899,bonus_id=3518,enchant=mark_of_the_trained_soldier
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518
back=reap_and_sow,id=144364,ilevel=940,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3518
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518
legs=master_warmages_leggings,id=140852,bonus_id=3518
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=spellblades_gemmed_signet,id=140895,bonus_id=3518,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=erratic_metronome,id=140792,bonus_id=3445
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=909.60
# gear_stamina=35271
# gear_intellect=39649
# gear_crit_rating=6515
# gear_haste_rating=4773
# gear_mastery_rating=11780
# gear_versatility_rating=1085
# gear_armor=2004
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Sacrolashs_Dark_Strike : 936185 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
936185.2 936185.2 1474.1 / 0.157% 210086.8 / 22.4% 30.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
28198.3 28198.3 Mana 0.00% 32.4 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sacrolashs_Dark_Strike 936185
Agony 134111 14.3% 17.3 18.09sec 2327419 1887331 Periodic 189.2 145401 385229 212491 28.0% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.28 0.00 189.22 189.22 1.2332 1.5811 40207689.06 40207689.06 0.00 125462.79 1887330.50
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 136.3 72.03% 145401.03 13731 243300 145434.93 129461 163620 19816431 19816431 0.00
crit 52.9 27.97% 385229.08 31855 642311 385181.80 286969 469007 20391258 20391258 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 6164 0.7% 25.2 11.82sec 73397 0 Direct 25.2 60693 121564 73395 20.9%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.18 25.18 0.00 0.00 0.0000 0.0000 1848295.19 1848295.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.93 79.13% 60692.82 19678 189612 60918.43 35592 99164 1209445 1209445 0.00
crit 5.26 20.87% 121563.53 39356 379224 121409.05 0 300409 638850 638850 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 134691 14.4% 21.9 13.85sec 1840575 1526616 Periodic 188.8 146565 387178 213851 28.0% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 0.00 188.80 188.80 1.2057 1.5775 40375944.43 40375944.43 0.00 124510.28 1526616.17
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 136.0 72.03% 146565.47 309 240214 146619.52 125999 162583 19932903 19932903 0.00
crit 52.8 27.97% 387177.67 1800 634164 387344.90 306579 457785 20443042 20443042 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 113692 12.2% 64.1 4.64sec 531738 186374 Periodic 217.1 121908 246314 156964 28.2% 56.8%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.10 0.00 217.14 217.14 2.8531 0.7853 34084227.42 34084227.42 0.00 186373.80 186373.80
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 156.0 71.82% 121907.54 78221 159277 121980.63 110312 131567 19012512 19012512 0.00
crit 61.2 28.18% 246313.82 156441 318553 246409.07 218193 271930 15071715 15071715 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 23568 2.5% 49.6 6.00sec 142590 0 Direct 49.3 118548 236899 143296 20.9%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.55 49.31 0.00 0.00 0.0000 0.0000 7065509.12 7065509.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.00 79.09% 118547.94 79942 154062 118544.64 106836 129298 4623416 4623416 0.00
crit 10.31 20.91% 236898.81 159885 308124 236880.11 168194 279276 2442094 2442094 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Soul 18020 1.9% 15.8 17.87sec 340777 0 Direct 15.8 281534 562627 340787 21.1%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.85 15.85 0.00 0.00 0.0000 0.0000 5400966.82 5400966.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.51 78.92% 281533.93 184480 355523 281288.35 208680 355523 3521480 3521480 0.00
crit 3.34 21.08% 562627.24 368960 711046 540873.07 0 711046 1879487 1879487 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (428749) 0.0% (45.8%) 47.0 6.35sec 2731910 2298557

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.00 0.00 0.00 0.00 1.1885 0.0000 0.00 0.00 0.00 2298556.75 2298556.75
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 189712 20.3% 0.0 0.00sec 0 0 Periodic 108.0 317600 848024 526433 39.4% 50.8%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 108.04 108.04 0.0000 1.4095 56876643.76 56876643.76 0.00 373485.70 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.5 60.63% 317600.37 341 493107 318087.98 251706 379095 20803624 20803624 0.00
crit 42.5 39.37% 848024.04 1269 1301803 848993.82 667773 1045494 36073020 36073020 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 148762 15.9% 0.0 0.00sec 0 0 Periodic 79.5 336930 895627 560453 40.0% 36.9%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 79.52 79.52 0.0000 1.3913 44564523.82 44564523.82 0.00 402839.51 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.7 59.99% 336929.69 264 493107 337955.82 280190 406566 16073141 16073141 0.00
crit 31.8 40.01% 895626.99 1610 1301803 897787.56 633042 1120275 28491383 28491383 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 83723 8.9% 0.0 0.00sec 0 0 Periodic 43.5 345994 918324 574703 40.0% 19.7%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 43.51 43.51 0.0000 1.3568 25002606.53 25002606.53 0.00 423564.80 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.1 60.04% 345993.79 620 493107 349817.77 230980 493107 9037650 9037650 0.00
crit 17.4 39.96% 918323.51 1523 1301803 927559.59 568477 1301803 15964957 15964957 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 5633 0.6% 0.0 0.00sec 0 0 Periodic 3.2 319495 847605 529318 39.7% 1.5%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 3.17 3.17 0.0000 1.4016 1676222.84 1676222.84 0.00 377697.80 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.9 60.27% 319494.72 2068 493107 150389.45 0 493107 609693 609693 0.00
crit 1.3 39.73% 847605.06 1504 1301803 373039.57 0 1301803 1066530 1066530 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 919 0.1% 0.0 0.00sec 0 0 Periodic 0.5 305891 807349 503413 39.4% 0.3%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.54 0.54 0.0000 1.4185 270487.46 270487.46 0.00 354970.42 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 60.61% 305891.38 1376 493107 31176.82 0 493107 99618 99618 0.00
crit 0.2 39.39% 807349.38 8801 1301803 74358.36 0 1301803 170869 170869 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 77189 / 77189
Doom Bolt 77189 8.3% 121.6 2.46sec 190357 79456 Direct 120.8 158331 316593 191586 21.0%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.58 120.80 0.00 0.00 2.3958 0.0000 23143648.74 23143648.74 0.00 79456.08 79456.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.41 78.99% 158331.18 131346 227391 158375.86 149114 166257 15107293 15107293 0.00
crit 25.38 21.01% 316592.95 262692 454781 316668.58 289770 350471 8036356 8036356 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Sacrolashs_Dark_Strike
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sacrolashs_Dark_Strike
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sacrolashs_Dark_Strike
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sacrolashs_Dark_Strike
  • harmful:false
  • if_expr:
 
Life Tap 11.1 23.29sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.12 0.00 0.00 0.00 1.2259 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 12.4 24.64sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.44 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.3 154.24sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.29 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.9 0.0 15.4sec 15.4sec 78.07% 78.07% 2.1(2.1) 19.1

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.09%
  • accelerando_2:23.68%
  • accelerando_3:14.56%
  • accelerando_4:6.92%
  • accelerando_5:3.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 22.4 24.6 13.6sec 0.0sec 56.10% 56.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:29.24%
  • active_uas_2:17.25%
  • active_uas_3:9.36%
  • active_uas_4:0.21%
  • active_uas_5:0.05%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 27.4 38.6 10.9sec 4.5sec 61.21% 100.00% 2.2(2.2) 1.6

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:25.76%
  • compounding_horror_2:16.69%
  • compounding_horror_3:9.89%
  • compounding_horror_4:5.04%
  • compounding_horror_5:3.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 12.4 0.0 24.7sec 24.7sec 74.42% 74.42% 0.0(0.0) 11.5

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:74.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.5sec 68.5sec 8.82% 8.82% 0.0(0.0) 3.3

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.82%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.5 0.0 68.8sec 67.9sec 13.69% 13.69% 0.0(0.0) 3.4

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.69%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 164.5sec 0.0sec 38.33% 38.33% 0.0(0.0) 1.9

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:38.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.3 0.0 154.4sec 154.4sec 12.85% 12.85% 0.0(0.0) 2.2

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:12.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 13.1 34.6 23.7sec 6.7sec 76.39% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:22.80%
  • tormented_souls_2:18.56%
  • tormented_souls_3:13.74%
  • tormented_souls_4:9.52%
  • tormented_souls_5:5.68%
  • tormented_souls_6:3.24%
  • tormented_souls_7:1.79%
  • tormented_souls_8:0.61%
  • tormented_souls_9:0.26%
  • tormented_souls_10:0.12%
  • tormented_souls_11:0.05%
  • tormented_souls_12:0.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 5.9 41.8sec
t18_2pc_affliction 47.0 6.4sec
soul_conduit 9.5 28.2sec
souls_consumed 46.1 24.7sec

Resources

Resource Usage Type Count Total Average RPE APR
Sacrolashs_Dark_Strike
agony Mana 17.3 570089.3 33000.0 32999.6 70.5
corruption Mana 21.9 723909.1 33000.0 33000.1 55.8
drain_soul Mana 217.1 7165867.9 33000.0 111792.7 4.8
unstable_affliction Soul Shard 47.0 47.0 1.0 1.0 2732049.4
pet - doomguard
doom_bolt Energy 121.6 4255.3 35.0 35.0 5438.8
Resource Gains Type Count Total Average Overflow
life_tap Mana 11.12 3668059.16 (48.06%) 330000.00 0.00 0.00%
agony Soul Shard 34.77 34.77 (77.51%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.60 0.60 (1.33%) 1.00 0.00 0.00%
mp5_regen Mana 346.95 3963667.07 (51.94%) 11424.44 21741.21 0.55%
soul_conduit Soul Shard 9.49 9.49 (21.16%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 196.34 4213.84 (100.00%) 21.46 117.71 2.72%
Resource RPS-Gain RPS-Loss
Health 0.00 12703.29
Mana 25437.88 28198.28
Soul Shard 0.15 0.16
Combat End Resource Mean Min Max
Mana 274712.64 43690.99 492463.52
Soul Shard 0.87 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Sacrolashs_Dark_Strike Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Sacrolashs_Dark_Strike Damage Per Second
Count 4999
Mean 936185.16
Minimum 736869.33
Maximum 1160257.07
Spread ( max - min ) 423387.74
Range [ ( max - min ) / 2 * 100% ] 22.61%
Standard Deviation 53178.3304
5th Percentile 852267.64
95th Percentile 1025842.77
( 95th Percentile - 5th Percentile ) 173575.13
Mean Distribution
Standard Deviation 752.1304
95.00% Confidence Intervall ( 934711.01 - 937659.31 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 124
0.1% Error 12395
0.1 Scale Factor Error with Delta=300 24140879
0.05 Scale Factor Error with Delta=300 96563513
0.01 Scale Factor Error with Delta=300 2414087819
Priority Target DPS
Sample Data Sacrolashs_Dark_Strike Priority Target Damage Per Second
Count 4999
Mean 936185.16
Minimum 736869.33
Maximum 1160257.07
Spread ( max - min ) 423387.74
Range [ ( max - min ) / 2 * 100% ] 22.61%
Standard Deviation 53178.3304
5th Percentile 852267.64
95th Percentile 1025842.77
( 95th Percentile - 5th Percentile ) 173575.13
Mean Distribution
Standard Deviation 752.1304
95.00% Confidence Intervall ( 934711.01 - 937659.31 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 124
0.1% Error 12395
0.1 Scale Factor Error with Delta=300 24140879
0.05 Scale Factor Error with Delta=300 96563513
0.01 Scale Factor Error with Delta=300 2414087819
DPS(e)
Sample Data Sacrolashs_Dark_Strike Damage Per Second (Effective)
Count 4999
Mean 936185.16
Minimum 736869.33
Maximum 1160257.07
Spread ( max - min ) 423387.74
Range [ ( max - min ) / 2 * 100% ] 22.61%
Damage
Sample Data Sacrolashs_Dark_Strike Damage
Count 4999
Mean 257373116.44
Minimum 173525945.34
Maximum 355519721.73
Spread ( max - min ) 181993776.38
Range [ ( max - min ) / 2 * 100% ] 35.36%
DTPS
Sample Data Sacrolashs_Dark_Strike Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sacrolashs_Dark_Strike Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sacrolashs_Dark_Strike Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sacrolashs_Dark_Strike Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sacrolashs_Dark_Strike Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sacrolashs_Dark_Strike Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Sacrolashs_Dark_StrikeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Sacrolashs_Dark_Strike Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 1.48 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 4.60 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
D 2.29 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
E 0.96 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 0.89 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
G 12.68 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
H 10.52 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
I 14.37 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
J 6.67 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
K 5.78 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
L 1.70 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
M 39.68 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
N 8.70 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
O 2.26 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
P 0.60 life_tap,if=mana.pct<=10
Q 48.74 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACIMMMDNQIQGMMMQIQGMMMNQIQMQQHQCQIMMNQGIHMMMNQIQGMMNQJQHQGMOQIQMMQQGHIMMNQIGMQMNQHQJQGMMQNQJMMNQQHQGQIMMNQHQGIMOQMQHQIQGMQMNQJQHGMMNQJQMQCIHMMNQIGMOQHKJQBCKQJKKKDEQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Sacrolashs_Dark_Strike 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Sacrolashs_Dark_Strike 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Sacrolashs_Dark_Strike 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.336 default I corruption Fluffy_Pillow 1088928.2/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:02.346 default M unstable_affliction Fluffy_Pillow 1072505.7/1100000: 98% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:03.355 default M unstable_affliction Fluffy_Pillow 1089066.8/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, accelerando, potion_of_prolonged_power
0:04.365 default M unstable_affliction Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), accelerando, potion_of_prolonged_power
0:05.374 default D soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, active_uas(3), accelerando, potion_of_prolonged_power
0:05.374 default N reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, active_uas(3), accelerando, potion_of_prolonged_power
0:05.374 default Q drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
0:11.514 default I corruption Fluffy_Pillow 904388.6/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:12.506 default Q drain_soul Fluffy_Pillow 887664.9/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(3), potion_of_prolonged_power
0:14.012 default G agony Fluffy_Pillow 845953.3/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(3), potion_of_prolonged_power
0:15.039 default M unstable_affliction Fluffy_Pillow 829602.5/1100000: 75% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(3), accelerando, potion_of_prolonged_power
0:16.048 default M unstable_affliction Fluffy_Pillow 846163.5/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas, accelerando, potion_of_prolonged_power
0:17.057 default M unstable_affliction Fluffy_Pillow 862724.6/1100000: 78% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas(2), accelerando, potion_of_prolonged_power
0:18.067 default Q drain_soul Fluffy_Pillow 879302.1/1100000: 80% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas(3), accelerando, potion_of_prolonged_power
0:25.677 default I corruption Fluffy_Pillow 642428.1/1100000: 58% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, tormented_souls(2), compounding_horror(3), accelerando(2), potion_of_prolonged_power
0:26.669 default Q drain_soul Fluffy_Pillow 625993.5/1100000: 57% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls(3), compounding_horror(4), accelerando(2), potion_of_prolonged_power
0:31.551 default G agony Fluffy_Pillow 474248.3/1100000: 43% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(3), compounding_horror(5), accelerando, potion_of_prolonged_power
0:32.560 default M unstable_affliction Fluffy_Pillow 458041.0/1100000: 42% mana | 2.0/5: 40% soul_shard bloodlust, tormented_souls(4), compounding_horror(5), nefarious_pact, accelerando(2), potion_of_prolonged_power
0:33.316 default M unstable_affliction Fluffy_Pillow 470665.5/1100000: 43% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(4), active_uas, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:34.071 default M unstable_affliction Fluffy_Pillow 483273.2/1100000: 44% mana | 1.0/5: 20% soul_shard bloodlust, tormented_souls(4), active_uas(2), nefarious_pact, accelerando(2), potion_of_prolonged_power
0:34.825 default N reap_souls Fluffy_Pillow 495864.2/1100000: 45% mana | 0.0/5: 0% soul_shard bloodlust, tormented_souls(4), active_uas(3), nefarious_pact, accelerando(2), potion_of_prolonged_power
0:34.825 default Q drain_soul Fluffy_Pillow 495864.2/1100000: 45% mana | 0.0/5: 0% soul_shard bloodlust, deadwind_harvester, active_uas(3), nefarious_pact, accelerando(2), potion_of_prolonged_power
0:39.679 default I corruption Fluffy_Pillow 246921.0/1100000: 22% mana | 0.0/5: 0% soul_shard bloodlust, deadwind_harvester, compounding_horror(3), nefarious_pact, accelerando(2), potion_of_prolonged_power
0:40.434 default Q drain_soul Fluffy_Pillow 226528.7/1100000: 21% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, tormented_souls, compounding_horror(3), nefarious_pact, accelerando(2), potion_of_prolonged_power
0:41.643 default M unstable_affliction Fluffy_Pillow 176182.2/1100000: 16% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), nefarious_pact, accelerando(3), potion_of_prolonged_power
0:42.510 default Q drain_soul Fluffy_Pillow 187088.5/1100000: 17% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, nefarious_pact, potion_of_prolonged_power
0:44.476 default Q drain_soul Fluffy_Pillow 112706.2/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, devils_due, accelerando, potion_of_prolonged_power
0:46.900 default H life_tap Fluffy_Pillow 77310.8/1100000: 7% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, devils_due, accelerando, potion_of_prolonged_power
0:48.455 default Q drain_soul Fluffy_Pillow 426943.6/1100000: 39% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, devils_due, accelerando, potion_of_prolonged_power
0:50.793 default C agony Fluffy_Pillow 390462.4/1100000: 35% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, devils_due, accelerando, potion_of_prolonged_power
0:52.349 default Q drain_soul Fluffy_Pillow 377141.6/1100000: 34% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(2), potion_of_prolonged_power
0:54.294 default I corruption Fluffy_Pillow 336431.8/1100000: 31% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(3), potion_of_prolonged_power
0:55.560 default M unstable_affliction Fluffy_Pillow 319893.1/1100000: 29% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), potion_of_prolonged_power
0:56.894 default M unstable_affliction Fluffy_Pillow 336442.6/1100000: 31% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas, potion_of_prolonged_power
0:58.228 default N reap_souls Fluffy_Pillow 352992.2/1100000: 32% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(2)
0:58.228 default Q drain_soul Fluffy_Pillow 352992.2/1100000: 32% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2)
1:07.188 default G agony Fluffy_Pillow 137154.6/1100000: 12% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, accelerando(2)
1:08.479 default I corruption Fluffy_Pillow 120890.0/1100000: 11% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, accelerando(3)
1:09.745 default H life_tap Fluffy_Pillow 104484.4/1100000: 9% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, accelerando(4)
1:10.991 default M unstable_affliction Fluffy_Pillow 451037.3/1100000: 41% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, accelerando(4)
1:12.236 default M unstable_affliction Fluffy_Pillow 466591.4/1100000: 42% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas, accelerando
1:13.546 default M unstable_affliction Fluffy_Pillow 483131.0/1100000: 44% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas(2), accelerando
1:14.855 default N reap_souls Fluffy_Pillow 499658.0/1100000: 45% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas(3), accelerando
1:14.855 default Q drain_soul Fluffy_Pillow 499658.0/1100000: 45% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(3), accelerando
1:22.122 default I corruption Fluffy_Pillow 327408.6/1100000: 30% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando
1:23.432 default Q drain_soul Fluffy_Pillow 310953.7/1100000: 28% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(2)
1:25.411 default G agony Fluffy_Pillow 269857.1/1100000: 25% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror(3)
1:26.744 default M unstable_affliction Fluffy_Pillow 253394.2/1100000: 23% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror(3)
1:28.078 default M unstable_affliction Fluffy_Pillow 269943.7/1100000: 25% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas
1:29.413 default N reap_souls Fluffy_Pillow 286505.7/1100000: 26% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(2)
1:29.413 default Q drain_soul Fluffy_Pillow 286505.7/1100000: 26% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2)
1:35.905 default J corruption Fluffy_Pillow 136787.7/1100000: 12% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), active_uas, accelerando(2)
1:37.193 default Q drain_soul Fluffy_Pillow 120801.8/1100000: 11% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), accelerando(4)
1:39.040 default H life_tap Fluffy_Pillow 79338.8/1100000: 7% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), accelerando(4)
1:40.286 default Q drain_soul Fluffy_Pillow 425891.6/1100000: 39% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), accelerando(4)
1:42.940 default G agony Fluffy_Pillow 362623.9/1100000: 33% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror(3), accelerando(5)
1:44.165 default M unstable_affliction Fluffy_Pillow 346166.9/1100000: 31% mana | 1.0/5: 20% soul_shard tormented_souls(3), compounding_horror(3), accelerando(5)
1:45.390 default O reap_souls Fluffy_Pillow 362094.7/1100000: 33% mana | 0.0/5: 0% soul_shard tormented_souls(4), active_uas
1:45.390 default Q drain_soul Fluffy_Pillow 362094.7/1100000: 33% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas
1:50.089 default I corruption Fluffy_Pillow 256238.8/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, accelerando
1:51.401 default Q drain_soul Fluffy_Pillow 239803.7/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, accelerando
1:53.489 default M unstable_affliction Fluffy_Pillow 200624.8/1100000: 18% mana | 2.0/5: 40% soul_shard deadwind_harvester, accelerando(2)
1:54.778 default M unstable_affliction Fluffy_Pillow 217182.4/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(2)
1:56.067 default Q drain_soul Fluffy_Pillow 233740.1/1100000: 21% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(2)
2:00.645 default Q drain_soul Fluffy_Pillow 127091.4/1100000: 12% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas, accelerando
2:02.669 default G agony Fluffy_Pillow 86645.7/1100000: 8% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando
2:03.980 default H life_tap Fluffy_Pillow 70283.8/1100000: 6% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(2)
2:05.268 default I corruption Fluffy_Pillow 416828.6/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(2)
2:06.557 default M unstable_affliction Fluffy_Pillow 400409.8/1100000: 36% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(2), accelerando(3)
2:07.825 default M unstable_affliction Fluffy_Pillow 416976.3/1100000: 38% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas, accelerando(3)
2:09.092 default N reap_souls Fluffy_Pillow 433529.8/1100000: 39% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas(2), accelerando(3)
2:09.092 default Q drain_soul Fluffy_Pillow 433529.8/1100000: 39% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(3)
2:17.786 default I corruption Fluffy_Pillow 215443.5/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(3)
2:19.051 default G agony Fluffy_Pillow 198988.2/1100000: 18% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(4)
2:20.295 default M unstable_affliction Fluffy_Pillow 182514.4/1100000: 17% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(4)
2:21.539 default Q drain_soul Fluffy_Pillow 199234.9/1100000: 18% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(5)
2:24.131 default M unstable_affliction Fluffy_Pillow 134546.5/1100000: 12% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror, active_uas
2:25.465 default N reap_souls Fluffy_Pillow 151096.0/1100000: 14% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas(2)
2:25.465 default Q drain_soul Fluffy_Pillow 151096.0/1100000: 14% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2)
2:27.409 default H life_tap Fluffy_Pillow 109624.2/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas(2), accelerando(2)
2:28.698 default Q drain_soul Fluffy_Pillow 456181.9/1100000: 41% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), active_uas, accelerando(2)
2:31.638 default J corruption Fluffy_Pillow 394947.2/1100000: 36% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), active_uas, accelerando(2)
2:32.927 default Q drain_soul Fluffy_Pillow 378504.9/1100000: 34% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), accelerando(2)
2:37.483 default G agony Fluffy_Pillow 272028.4/1100000: 25% mana | 1.0/5: 20% soul_shard compounding_horror(3), accelerando(2)
2:38.769 default M unstable_affliction Fluffy_Pillow 255083.5/1100000: 23% mana | 1.0/5: 20% soul_shard compounding_horror(3)
2:40.104 default M unstable_affliction Fluffy_Pillow 271771.3/1100000: 25% mana | 1.0/5: 20% soul_shard active_uas, accelerando
2:41.415 default Q drain_soul Fluffy_Pillow 288323.5/1100000: 26% mana | 0.0/5: 0% soul_shard active_uas(2), accelerando
2:44.339 default N reap_souls Fluffy_Pillow 226310.6/1100000: 21% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(2), accelerando(2)
2:44.339 default Q drain_soul Fluffy_Pillow 226310.6/1100000: 21% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(2)
2:46.324 default J corruption Fluffy_Pillow 185808.6/1100000: 17% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas(2), accelerando(2)
2:47.612 default M unstable_affliction Fluffy_Pillow 169353.5/1100000: 15% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas, accelerando(2)
2:48.901 default M unstable_affliction Fluffy_Pillow 185911.1/1100000: 17% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(2)
2:50.188 default N reap_souls Fluffy_Pillow 202501.1/1100000: 18% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas(2), accelerando(3)
2:50.188 default Q drain_soul Fluffy_Pillow 202501.1/1100000: 18% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(2), accelerando(3)
2:53.889 default Q drain_soul Fluffy_Pillow 117300.7/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas(2), nefarious_pact
2:55.346 default H life_tap Fluffy_Pillow 69451.6/1100000: 6% mana | 2.0/5: 40% soul_shard tormented_souls, active_uas(2), nefarious_pact, accelerando
2:56.242 default Q drain_soul Fluffy_Pillow 410764.1/1100000: 37% mana | 2.0/5: 40% soul_shard tormented_souls, active_uas, nefarious_pact, accelerando
2:57.661 default G agony Fluffy_Pillow 362679.9/1100000: 33% mana | 2.0/5: 40% soul_shard tormented_souls, nefarious_pact, accelerando
2:58.558 default Q drain_soul Fluffy_Pillow 341005.1/1100000: 31% mana | 2.0/5: 40% soul_shard tormented_souls, nefarious_pact, accelerando
3:00.030 default I corruption Fluffy_Pillow 293729.4/1100000: 27% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror, nefarious_pact, accelerando(2)
3:00.913 default M unstable_affliction Fluffy_Pillow 272071.9/1100000: 25% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror, nefarious_pact, accelerando(2)
3:01.792 default M unstable_affliction Fluffy_Pillow 283362.9/1100000: 26% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas, nefarious_pact, accelerando(2)
3:02.674 default N reap_souls Fluffy_Pillow 294692.5/1100000: 27% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(2), nefarious_pact, accelerando(2)
3:02.674 default Q drain_soul Fluffy_Pillow 294692.5/1100000: 27% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), nefarious_pact, accelerando(2)
3:08.379 default H life_tap Fluffy_Pillow 104367.1/1100000: 9% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(3), devils_due
3:09.962 default Q drain_soul Fluffy_Pillow 454005.7/1100000: 41% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(3), devils_due
3:13.370 default G agony Fluffy_Pillow 397866.5/1100000: 36% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(3), nefarious_pact, accelerando(2)
3:14.251 default I corruption Fluffy_Pillow 376183.2/1100000: 34% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(3), nefarious_pact, accelerando(2)
3:15.132 default M unstable_affliction Fluffy_Pillow 354500.0/1100000: 32% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror(3), nefarious_pact, accelerando(2)
3:16.013 default O reap_souls Fluffy_Pillow 365816.8/1100000: 33% mana | 0.0/5: 0% soul_shard tormented_souls(4), active_uas, nefarious_pact, accelerando(2)
3:16.013 default Q drain_soul Fluffy_Pillow 365816.8/1100000: 33% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, nefarious_pact, accelerando(2)
3:17.439 default M unstable_affliction Fluffy_Pillow 318134.2/1100000: 29% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, nefarious_pact, accelerando(2)
3:18.319 default Q drain_soul Fluffy_Pillow 329438.2/1100000: 30% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas(2), nefarious_pact, accelerando(2)
3:23.813 default H life_tap Fluffy_Pillow 102978.1/1100000: 9% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), nefarious_pact
3:24.725 default Q drain_soul Fluffy_Pillow 444292.3/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), devils_due
3:28.143 default I corruption Fluffy_Pillow 387695.8/1100000: 35% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(4), devils_due
3:29.724 default Q drain_soul Fluffy_Pillow 374309.6/1100000: 34% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(4), devils_due
3:32.077 default G agony Fluffy_Pillow 337500.8/1100000: 31% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), devils_due
3:33.660 default M unstable_affliction Fluffy_Pillow 324208.2/1100000: 29% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), accelerando
3:34.969 default Q drain_soul Fluffy_Pillow 340735.2/1100000: 31% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando
3:36.998 default M unstable_affliction Fluffy_Pillow 301107.5/1100000: 27% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror, active_uas, accelerando(3)
3:38.263 default N reap_souls Fluffy_Pillow 317635.5/1100000: 29% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas(2), accelerando(4)
3:38.263 default Q drain_soul Fluffy_Pillow 317635.5/1100000: 29% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(4)
3:41.808 default J corruption Fluffy_Pillow 233116.9/1100000: 21% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas(2), accelerando(5)
3:43.033 default Q drain_soul Fluffy_Pillow 216659.9/1100000: 20% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas, accelerando(5)
3:47.415 default H life_tap Fluffy_Pillow 108564.8/1100000: 10% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3)
3:48.750 default G agony Fluffy_Pillow 455126.7/1100000: 41% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror(3)
3:50.085 default M unstable_affliction Fluffy_Pillow 438688.6/1100000: 40% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror(3)
3:51.418 default M unstable_affliction Fluffy_Pillow 455225.8/1100000: 41% mana | 1.0/5: 20% soul_shard tormented_souls(2), active_uas
3:52.753 default N reap_souls Fluffy_Pillow 471787.7/1100000: 43% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas(2)
3:52.753 default Q drain_soul Fluffy_Pillow 471787.7/1100000: 43% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2)
3:55.702 default J corruption Fluffy_Pillow 409856.2/1100000: 37% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), active_uas(2), accelerando(2)
3:56.991 default Q drain_soul Fluffy_Pillow 393413.9/1100000: 36% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2), active_uas(2), accelerando(2)
4:01.555 default M unstable_affliction Fluffy_Pillow 287102.5/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(5), accelerando(3)
4:02.821 default Q drain_soul Fluffy_Pillow 303728.8/1100000: 28% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando(4)
4:09.895 default C agony Fluffy_Pillow 131333.7/1100000: 12% mana | 0.0/5: 0% soul_shard tormented_souls, compounding_horror, accelerando
4:11.206 default I corruption Fluffy_Pillow 114886.0/1100000: 10% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, accelerando
4:12.516 default H life_tap Fluffy_Pillow 98425.6/1100000: 9% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, accelerando
4:13.826 default M unstable_affliction Fluffy_Pillow 445228.4/1100000: 40% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, accelerando(2)
4:15.114 default M unstable_affliction Fluffy_Pillow 461936.7/1100000: 42% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas, accelerando(3)
4:16.381 default N reap_souls Fluffy_Pillow 478490.1/1100000: 43% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(2), accelerando(3)
4:16.381 default Q drain_soul Fluffy_Pillow 478490.1/1100000: 43% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(3)
4:24.194 default I corruption Fluffy_Pillow 281887.4/1100000: 26% mana | 1.0/5: 20% soul_shard tormented_souls
4:25.529 default G agony Fluffy_Pillow 265449.3/1100000: 24% mana | 1.0/5: 20% soul_shard tormented_souls
4:26.864 default M unstable_affliction Fluffy_Pillow 249108.2/1100000: 23% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror, accelerando
4:28.174 default O reap_souls Fluffy_Pillow 265647.8/1100000: 24% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas, accelerando
4:28.174 default Q drain_soul Fluffy_Pillow 265647.8/1100000: 24% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando
4:35.327 default H life_tap Fluffy_Pillow 92766.0/1100000: 8% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), accelerando(2)
4:36.614 default K unstable_affliction Fluffy_Pillow 439298.0/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), accelerando(2)
4:37.904 default J corruption Fluffy_Pillow 455869.9/1100000: 41% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(3)
4:39.170 default Q drain_soul Fluffy_Pillow 438917.9/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas
4:45.686 default B reap_souls Fluffy_Pillow 288755.0/1100000: 26% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror
4:45.686 default C agony Fluffy_Pillow 288755.0/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror
4:47.022 default K unstable_affliction Fluffy_Pillow 272329.4/1100000: 25% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2)
4:48.356 default Q drain_soul Fluffy_Pillow 289091.3/1100000: 26% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(2)
4:52.115 default J corruption Fluffy_Pillow 205451.5/1100000: 19% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, accelerando(3)
4:53.383 default K unstable_affliction Fluffy_Pillow 189018.0/1100000: 17% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, accelerando(3)
4:54.648 default K unstable_affliction Fluffy_Pillow 205545.4/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), accelerando(3)
4:55.914 default K unstable_affliction Fluffy_Pillow 222085.7/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), accelerando(3)
4:57.180 default D soul_harvest Fluffy_Pillow 238626.1/1100000: 22% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(3), accelerando(3)
4:57.180 default E potion Fluffy_Pillow 238626.1/1100000: 22% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), active_uas(3), accelerando(3)
4:57.180 default Q drain_soul Fluffy_Pillow 238626.1/1100000: 22% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), active_uas(3), accelerando(3), potion_of_prolonged_power

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 56169 56169 35271
Intellect 50513 48806 39155 (1278)
Spirit 0 0 0
Health 3370140 3370140 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50513 48806 0
Crit 20.96% 20.96% 6383
Haste 12.78% 12.78% 4793
Damage / Heal Versatility 2.33% 2.33% 1107
ManaReg per Second 12406 12406 0
Mastery 130.34% 127.37% 13102
Armor 1983 1983 1983
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 910.00
Local Head Eyes of Azj'Aqir
ilevel: 905, stats: { 257 Armor, +3410 Sta, +2273 Int, +1094 Haste, +589 Vers }
Local Neck Beleron's Choker of Misery
ilevel: 905, stats: { +1918 Sta, +1727 Crit, +1295 Mastery }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Master Warmage's Leggings
ilevel: 905, stats: { 277 Armor, +3410 Sta, +2273 Int, +914 Mastery, +769 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Bracers of Harnessed Flame
ilevel: 905, stats: { 139 Armor, +1918 Sta, +1278 Int, +595 Mastery, +351 Crit }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Sacrolash's Dark Strike
ilevel: 940, stats: { +2658 Sta, +1816 Crit, +1923 Mastery }, gems: { +150 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Temporal Recalibration
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +636 Mastery, +311 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Sacrolashs_Dark_Strike"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3518
neck=belerons_choker_of_misery,id=140899,bonus_id=3518,enchant=mark_of_the_trained_soldier
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518
back=cloak_of_temporal_recalibration,id=140910,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3518
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518
legs=master_warmages_leggings,id=140852,bonus_id=3518
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=sacrolashs_dark_strike,id=132378,ilevel=940,gems=150mastery,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=erratic_metronome,id=140792,bonus_id=3445
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=909.60
# gear_stamina=35271
# gear_intellect=39155
# gear_crit_rating=6258
# gear_haste_rating=4699
# gear_mastery_rating=12845
# gear_versatility_rating=1085
# gear_armor=1983
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Sephuzs_Secret : 936482 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
936481.7 936481.7 1428.1 / 0.152% 202935.0 / 21.7% 28.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
29496.5 29496.5 Mana 0.00% 33.3 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sephuzs_Secret 936482
Agony 135001 14.4% 17.3 18.09sec 2343800 1985710 Periodic 198.2 136380 361256 204258 30.2% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.27 0.00 198.16 198.16 1.1804 1.5099 40474736.99 40474736.99 0.00 126646.61 1985710.49
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 138.3 69.82% 136379.65 12818 227126 136405.81 120648 151906 18867389 18867389 0.00
crit 59.8 30.18% 361256.10 29737 599613 361193.22 287172 422097 21607348 21607348 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 6691 0.7% 26.4 11.18sec 75901 0 Direct 26.4 61823 122509 75900 23.2%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.42 26.42 0.00 0.00 0.0000 0.0000 2005485.86 2005485.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.29 76.80% 61822.65 19678 189612 62029.12 35584 108103 1254523 1254523 0.00
crit 6.13 23.20% 122508.68 39356 379224 122532.49 0 287980 750963 750963 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 117928 12.6% 21.9 13.85sec 1611224 1396117 Periodic 197.6 119632 315792 178932 30.2% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 0.00 197.55 197.55 1.1541 1.5081 35348297.34 35348297.34 0.00 109352.14 1396117.44
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 137.8 69.77% 119631.86 139 194996 119686.98 103759 132725 16488587 16488587 0.00
crit 59.7 30.23% 315791.99 3780 514789 315806.55 252027 366839 18859710 18859710 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 122120 13.0% 67.0 4.44sec 546662 198056 Periodic 229.0 122126 246281 159874 30.4% 57.3%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.96 0.00 228.95 228.95 2.7601 0.7514 36603356.61 36603356.61 0.00 198056.18 198056.18
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 159.3 69.60% 122125.50 78221 159277 122186.86 111590 131108 19459483 19459483 0.00
crit 69.6 30.40% 246281.04 156441 318553 246350.72 217046 269704 17143874 17143874 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 25329 2.7% 52.2 5.65sec 145466 0 Direct 52.0 118681 237501 146140 23.1%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.21 51.97 0.00 0.00 0.0000 0.0000 7595357.64 7595357.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.96 76.89% 118681.31 79942 154062 118678.75 106885 129929 4742840 4742840 0.00
crit 12.01 23.11% 237501.03 159885 308124 237559.85 186630 295317 2852518 2852518 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Soul 19354 2.1% 16.7 16.85sec 346622 0 Direct 16.7 281380 563700 346638 23.1%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.73 16.73 0.00 0.00 0.0000 0.0000 5800149.66 5800149.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.87 76.89% 281380.21 184480 355523 281061.91 221998 355523 3620281 3620281 0.00
crit 3.87 23.11% 563700.00 368960 711046 549193.64 0 711046 2179869 2179869 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (427739) 0.0% (45.7%) 49.0 6.08sec 2613708 2293880

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.03 0.00 0.00 0.00 1.1394 0.0000 0.00 0.00 0.00 2293880.07 2293880.07
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 188345 20.1% 0.0 0.00sec 0 0 Periodic 111.9 298278 792987 504422 41.7% 50.4%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 111.94 111.94 0.0000 1.3507 56462936.33 56462936.33 0.00 373461.76 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.3 58.33% 298277.75 556 460327 298747.04 242123 354913 19474570 19474570 0.00
crit 46.6 41.67% 792987.37 803 1215263 793651.02 615394 995858 36988366 36988366 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 149469 16.0% 0.0 0.00sec 0 0 Periodic 83.4 315631 839480 537119 42.3% 37.2%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 83.39 83.39 0.0000 1.3373 44790717.51 44790717.51 0.00 401634.83 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.1 57.72% 315631.09 431 460327 316421.51 254629 378923 15192167 15192167 0.00
crit 35.3 42.28% 839479.90 1544 1215263 841628.14 575221 1009649 29598550 29598550 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 83475 8.9% 0.0 0.00sec 0 0 Periodic 45.3 325192 860648 550844 42.1% 19.7%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 45.33 45.33 0.0000 1.3030 24969818.61 24969818.61 0.00 422730.05 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.2 57.86% 325192.32 585 460327 328432.38 237473 460327 8528771 8528771 0.00
crit 19.1 42.14% 860647.75 1049 1215263 869517.87 488467 1215263 16441048 16441048 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 5514 0.6% 0.0 0.00sec 0 0 Periodic 3.2 297717 795174 505914 41.9% 1.5%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 3.24 3.24 0.0000 1.3430 1640198.50 1640198.50 0.00 376710.73 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.9 58.15% 297716.98 1189 460327 145929.18 0 460327 561249 561249 0.00
crit 1.4 41.85% 795174.33 3039 1215263 365554.46 0 1215263 1078949 1078949 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 937 0.1% 0.0 0.00sec 0 0 Periodic 0.6 282759 751716 487680 43.7% 0.3%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.57 0.57 0.0000 1.3627 277057.67 277057.67 0.00 357955.65 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 56.30% 282759.24 2096 460327 30151.00 0 460327 90444 90444 0.00
crit 0.2 43.70% 751715.78 5535 1215263 74870.15 0 1215263 186613 186613 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 82319 / 82319
Doom Bolt 82319 8.8% 127.1 2.35sec 194187 84754 Direct 126.3 158687 317309 195434 23.2%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.09 126.28 0.00 0.00 2.2912 0.0000 24679457.16 24679457.16 0.00 84753.79 84753.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.03 76.83% 158687.37 131346 227391 158732.56 148849 165624 15396998 15396998 0.00
crit 29.25 23.17% 317308.92 262692 454781 317349.54 286910 350214 9282459 9282459 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Sephuzs_Secret
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sephuzs_Secret
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sephuzs_Secret
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sephuzs_Secret
  • harmful:false
  • if_expr:
 
Life Tap 11.7 22.24sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.75 0.00 0.00 0.00 1.1697 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 12.5 24.66sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.53 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.3 152.73sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.32 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.9 0.0 15.5sec 15.5sec 77.97% 77.97% 2.1(2.1) 19.1

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.10%
  • accelerando_2:23.65%
  • accelerando_3:14.47%
  • accelerando_4:6.89%
  • accelerando_5:3.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 23.1 25.8 13.1sec 0.0sec 55.93% 55.93% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:28.77%
  • active_uas_2:17.42%
  • active_uas_3:9.48%
  • active_uas_4:0.21%
  • active_uas_5:0.05%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 28.4 41.2 10.6sec 4.2sec 61.78% 100.00% 2.5(2.5) 1.4

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:25.65%
  • compounding_horror_2:16.89%
  • compounding_horror_3:10.01%
  • compounding_horror_4:5.23%
  • compounding_horror_5:3.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 12.5 0.0 24.5sec 24.5sec 75.46% 75.46% 0.0(0.0) 11.6

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:75.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.7sec 68.7sec 8.80% 8.80% 0.0(0.0) 3.3

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.80%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.5 0.0 69.0sec 68.3sec 13.69% 13.69% 0.0(0.0) 3.4

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.69%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 163.0sec 0.0sec 38.61% 38.61% 0.0(0.0) 1.9

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:38.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.3 0.0 153.1sec 153.1sec 12.99% 12.99% 0.0(0.0) 2.3

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:12.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 13.2 35.3 23.5sec 6.5sec 76.78% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:22.63%
  • tormented_souls_2:18.45%
  • tormented_souls_3:13.86%
  • tormented_souls_4:9.62%
  • tormented_souls_5:5.76%
  • tormented_souls_6:3.38%
  • tormented_souls_7:1.89%
  • tormented_souls_8:0.66%
  • tormented_souls_9:0.28%
  • tormented_souls_10:0.13%
  • tormented_souls_11:0.07%
  • tormented_souls_12:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 6.1 40.6sec
t18_2pc_affliction 49.0 6.1sec
soul_conduit 9.8 27.5sec
souls_consumed 46.8 24.5sec

Resources

Resource Usage Type Count Total Average RPE APR
Sephuzs_Secret
agony Mana 17.3 569865.1 33000.0 32999.6 71.0
corruption Mana 21.9 723981.6 33000.0 33000.1 48.8
drain_soul Mana 229.0 7555529.1 33000.0 112839.8 4.8
unstable_affliction Soul Shard 49.0 49.0 1.0 1.0 2613741.5
pet - doomguard
doom_bolt Energy 127.1 4448.2 35.0 35.0 5548.2
Resource Gains Type Count Total Average Overflow
life_tap Mana 11.75 3876098.34 (48.32%) 330000.00 0.00 0.00%
agony Soul Shard 36.47 36.47 (77.75%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.60 0.60 (1.28%) 1.00 0.00 0.00%
mp5_regen Mana 357.60 4144924.64 (51.68%) 11590.96 22088.68 0.53%
soul_conduit Soul Shard 9.83 9.83 (20.97%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 203.46 4406.80 (100.00%) 21.66 123.28 2.72%
Resource RPS-Gain RPS-Loss
Health 0.00 13428.58
Mana 26735.17 29496.50
Soul Shard 0.16 0.16
Combat End Resource Mean Min Max
Mana 271873.38 33266.22 486076.69
Soul Shard 0.87 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Sephuzs_Secret Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Sephuzs_Secret Damage Per Second
Count 4999
Mean 936481.69
Minimum 768411.23
Maximum 1137696.92
Spread ( max - min ) 369285.70
Range [ ( max - min ) / 2 * 100% ] 19.72%
Standard Deviation 51515.9672
5th Percentile 853687.90
95th Percentile 1024450.01
( 95th Percentile - 5th Percentile ) 170762.11
Mean Distribution
Standard Deviation 728.6187
95.00% Confidence Intervall ( 935053.63 - 937909.76 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 117
0.1% Error 11625
0.1 Scale Factor Error with Delta=300 22655174
0.05 Scale Factor Error with Delta=300 90620693
0.01 Scale Factor Error with Delta=300 2265517311
Priority Target DPS
Sample Data Sephuzs_Secret Priority Target Damage Per Second
Count 4999
Mean 936481.69
Minimum 768411.23
Maximum 1137696.92
Spread ( max - min ) 369285.70
Range [ ( max - min ) / 2 * 100% ] 19.72%
Standard Deviation 51515.9672
5th Percentile 853687.90
95th Percentile 1024450.01
( 95th Percentile - 5th Percentile ) 170762.11
Mean Distribution
Standard Deviation 728.6187
95.00% Confidence Intervall ( 935053.63 - 937909.76 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 117
0.1% Error 11625
0.1 Scale Factor Error with Delta=300 22655174
0.05 Scale Factor Error with Delta=300 90620693
0.01 Scale Factor Error with Delta=300 2265517311
DPS(e)
Sample Data Sephuzs_Secret Damage Per Second (Effective)
Count 4999
Mean 936481.69
Minimum 768411.23
Maximum 1137696.92
Spread ( max - min ) 369285.70
Range [ ( max - min ) / 2 * 100% ] 19.72%
Damage
Sample Data Sephuzs_Secret Damage
Count 4999
Mean 255968112.73
Minimum 173713615.81
Maximum 350687029.13
Spread ( max - min ) 176973413.32
Range [ ( max - min ) / 2 * 100% ] 34.57%
DTPS
Sample Data Sephuzs_Secret Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sephuzs_Secret Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sephuzs_Secret Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sephuzs_Secret Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sephuzs_Secret Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sephuzs_Secret Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Sephuzs_SecretTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Sephuzs_Secret Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 1.51 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 4.19 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
D 2.32 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
E 0.97 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 0.69 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
G 13.08 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
H 11.12 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
I 14.96 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
J 6.29 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
K 6.07 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
L 1.85 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
M 41.28 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
N 8.81 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
O 2.21 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
P 0.63 life_tap,if=mana.pct<=10
Q 50.52 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACIMMMDNQIQGMMMQIQLQCQLOQJQMMQNQQCHIMKMNQGIMMMNQQHIQGMMMNQIHQGMQJQMMMQHQGIMMMDENQHIQGMMMQNQJQGMQQHQIMOQGQIHMMMQGIMMNQQHNQIQGMQHIMQGQIMMNQQHQGQIMMMDNQIGMMNQQHKQJQGQBQQIPKKQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Sephuzs_Secret 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Sephuzs_Secret 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Sephuzs_Secret 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.275 default I corruption Fluffy_Pillow 1088885.6/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:02.240 default M unstable_affliction Fluffy_Pillow 1072450.0/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, accelerando, potion_of_prolonged_power
0:03.206 default M unstable_affliction Fluffy_Pillow 1089031.6/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, active_uas, accelerando, potion_of_prolonged_power
0:04.172 default M unstable_affliction Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(2), accelerando, potion_of_prolonged_power
0:05.137 default D soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(3), accelerando, potion_of_prolonged_power
0:05.137 default N reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, active_uas(3), accelerando, potion_of_prolonged_power
0:05.137 default Q drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
0:11.679 default I corruption Fluffy_Pillow 875268.7/1100000: 80% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, accelerando(4), potion_of_prolonged_power
0:12.595 default Q drain_soul Fluffy_Pillow 858105.5/1100000: 78% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, accelerando, potion_of_prolonged_power
0:13.974 default G agony Fluffy_Pillow 815776.3/1100000: 74% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, accelerando, potion_of_prolonged_power
0:14.938 default M unstable_affliction Fluffy_Pillow 799323.5/1100000: 73% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, accelerando, potion_of_prolonged_power
0:15.904 default M unstable_affliction Fluffy_Pillow 815905.1/1100000: 74% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas, accelerando, potion_of_prolonged_power
0:16.870 default M unstable_affliction Fluffy_Pillow 832486.7/1100000: 76% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas(2), accelerando, potion_of_prolonged_power
0:17.834 default Q drain_soul Fluffy_Pillow 849033.9/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas(3), accelerando, potion_of_prolonged_power
0:26.194 default I corruption Fluffy_Pillow 568759.5/1100000: 52% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, tormented_souls(2), compounding_horror, potion_of_prolonged_power
0:27.176 default Q drain_soul Fluffy_Pillow 552329.7/1100000: 50% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, tormented_souls(2), compounding_horror, potion_of_prolonged_power
0:28.694 default L unstable_affliction Fluffy_Pillow 511944.2/1100000: 47% mana | 4.0/5: 80% soul_shard bloodlust, deadwind_harvester, tormented_souls(2), compounding_horror(2), potion_of_prolonged_power
0:29.675 default Q drain_soul Fluffy_Pillow 528497.5/1100000: 48% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, tormented_souls(2), active_uas, potion_of_prolonged_power
0:34.448 default C agony Fluffy_Pillow 378868.7/1100000: 34% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls(2), active_uas, accelerando, potion_of_prolonged_power
0:35.415 default Q drain_soul Fluffy_Pillow 362467.5/1100000: 33% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls(2), accelerando, potion_of_prolonged_power
0:37.014 default L unstable_affliction Fluffy_Pillow 324007.7/1100000: 29% mana | 4.0/5: 80% soul_shard bloodlust, tormented_souls(2), accelerando(2), potion_of_prolonged_power
0:37.964 default O reap_souls Fluffy_Pillow 340591.8/1100000: 31% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls(2), active_uas, accelerando(2), potion_of_prolonged_power
0:37.964 default Q drain_soul Fluffy_Pillow 340591.8/1100000: 31% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, active_uas, accelerando(2), potion_of_prolonged_power
0:39.473 default J corruption Fluffy_Pillow 300934.2/1100000: 27% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, compounding_horror, active_uas, accelerando(2), potion_of_prolonged_power
0:40.423 default Q drain_soul Fluffy_Pillow 284518.3/1100000: 26% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, compounding_horror, active_uas, accelerando(2), potion_of_prolonged_power
0:41.979 default M unstable_affliction Fluffy_Pillow 239412.9/1100000: 22% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror(2), active_uas, accelerando(2), potion_of_prolonged_power
0:43.210 default M unstable_affliction Fluffy_Pillow 255943.2/1100000: 23% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas, accelerando(2), potion_of_prolonged_power
0:44.445 default Q drain_soul Fluffy_Pillow 272145.9/1100000: 25% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(2), accelerando, potion_of_prolonged_power
0:48.880 default N reap_souls Fluffy_Pillow 165705.6/1100000: 15% mana | 3.0/5: 60% soul_shard tormented_souls(2), compounding_horror, active_uas(2), accelerando, potion_of_prolonged_power
0:48.880 default Q drain_soul Fluffy_Pillow 165705.6/1100000: 15% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror, active_uas(2), accelerando, potion_of_prolonged_power
0:50.788 default Q drain_soul Fluffy_Pillow 124898.8/1100000: 11% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror, active_uas, accelerando, potion_of_prolonged_power
0:52.633 default C agony Fluffy_Pillow 83260.2/1100000: 8% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror(2), accelerando, potion_of_prolonged_power
0:53.885 default H life_tap Fluffy_Pillow 66791.6/1100000: 6% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando, potion_of_prolonged_power
0:55.138 default I corruption Fluffy_Pillow 413356.2/1100000: 38% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:56.371 default M unstable_affliction Fluffy_Pillow 396913.4/1100000: 36% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(2), potion_of_prolonged_power
0:57.603 default K unstable_affliction Fluffy_Pillow 412934.6/1100000: 38% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, active_uas, potion_of_prolonged_power
0:58.880 default M unstable_affliction Fluffy_Pillow 429534.8/1100000: 39% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas(2), accelerando(2)
1:00.113 default N reap_souls Fluffy_Pillow 446092.1/1100000: 41% mana | 2.0/5: 40% soul_shard tormented_souls, active_uas(3), accelerando(2)
1:00.113 default Q drain_soul Fluffy_Pillow 446092.1/1100000: 41% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(3), accelerando(2)
1:06.889 default G agony Fluffy_Pillow 273082.9/1100000: 25% mana | 2.0/5: 40% soul_shard compounding_horror(3), accelerando(2)
1:08.121 default I corruption Fluffy_Pillow 256626.6/1100000: 23% mana | 3.0/5: 60% soul_shard compounding_horror(3), accelerando(2)
1:09.356 default M unstable_affliction Fluffy_Pillow 240487.5/1100000: 22% mana | 3.0/5: 60% soul_shard compounding_horror(3), accelerando(3)
1:10.569 default M unstable_affliction Fluffy_Pillow 257048.0/1100000: 23% mana | 2.0/5: 40% soul_shard tormented_souls, active_uas, accelerando(3)
1:11.782 default M unstable_affliction Fluffy_Pillow 272931.1/1100000: 25% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas(2)
1:13.057 default N reap_souls Fluffy_Pillow 289480.5/1100000: 26% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(3)
1:13.057 default Q drain_soul Fluffy_Pillow 289480.5/1100000: 26% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3)
1:20.119 default Q drain_soul Fluffy_Pillow 119518.8/1100000: 11% mana | 1.0/5: 20% soul_shard tormented_souls(3), nefarious_pact, accelerando(2)
1:21.459 default H life_tap Fluffy_Pillow 71512.9/1100000: 7% mana | 1.0/5: 20% soul_shard tormented_souls(4), nefarious_pact, accelerando(2)
1:22.304 default I corruption Fluffy_Pillow 412859.9/1100000: 38% mana | 1.0/5: 20% soul_shard tormented_souls(4), compounding_horror, nefarious_pact, accelerando(2)
1:23.147 default Q drain_soul Fluffy_Pillow 391180.0/1100000: 36% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror, nefarious_pact, accelerando(2)
1:25.204 default G agony Fluffy_Pillow 319802.2/1100000: 29% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror(2), nefarious_pact, accelerando(2)
1:26.047 default M unstable_affliction Fluffy_Pillow 298311.3/1100000: 27% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror(2), nefarious_pact, accelerando(3)
1:26.875 default M unstable_affliction Fluffy_Pillow 309529.5/1100000: 28% mana | 2.0/5: 40% soul_shard tormented_souls(5), active_uas, nefarious_pact
1:27.747 default M unstable_affliction Fluffy_Pillow 320847.9/1100000: 29% mana | 1.0/5: 20% soul_shard tormented_souls(5), active_uas(2), nefarious_pact
1:28.620 default N reap_souls Fluffy_Pillow 332179.4/1100000: 30% mana | 0.0/5: 0% soul_shard tormented_souls(6), active_uas(3), nefarious_pact
1:28.620 default Q drain_soul Fluffy_Pillow 332179.4/1100000: 30% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(3), nefarious_pact
1:35.180 default I corruption Fluffy_Pillow 121910.3/1100000: 11% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), devils_due, accelerando(2)
1:36.642 default H life_tap Fluffy_Pillow 108542.7/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), devils_due, accelerando(2)
1:38.106 default Q drain_soul Fluffy_Pillow 458201.8/1100000: 42% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(2)
1:44.053 default G agony Fluffy_Pillow 307094.8/1100000: 28% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5)
1:45.330 default M unstable_affliction Fluffy_Pillow 290670.1/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5)
1:46.608 default Q drain_soul Fluffy_Pillow 307259.9/1100000: 28% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, nefarious_pact, accelerando
1:49.758 default J corruption Fluffy_Pillow 184149.7/1100000: 17% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, nefarious_pact, accelerando(3)
1:50.590 default Q drain_soul Fluffy_Pillow 162508.6/1100000: 15% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, nefarious_pact, accelerando(3)
1:51.852 default M unstable_affliction Fluffy_Pillow 113738.1/1100000: 10% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, nefarious_pact, accelerando(3)
1:52.681 default M unstable_affliction Fluffy_Pillow 125144.5/1100000: 11% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), active_uas, nefarious_pact, accelerando(4)
1:53.498 default M unstable_affliction Fluffy_Pillow 136481.7/1100000: 12% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), nefarious_pact, accelerando(4)
1:54.312 default Q drain_soul Fluffy_Pillow 147777.2/1100000: 13% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas(3), nefarious_pact, accelerando(4)
1:55.534 default H life_tap Fluffy_Pillow 98766.5/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, active_uas(3), nefarious_pact, accelerando(5)
1:56.339 default Q drain_soul Fluffy_Pillow 440117.5/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, active_uas(3), nefarious_pact, accelerando(5)
2:01.800 default G agony Fluffy_Pillow 249536.0/1100000: 23% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror, devils_due
2:03.314 default I corruption Fluffy_Pillow 236187.6/1100000: 21% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror, devils_due
2:04.827 default M unstable_affliction Fluffy_Pillow 222837.1/1100000: 20% mana | 2.0/5: 40% soul_shard tormented_souls(4), devils_due, accelerando
2:06.315 default M unstable_affliction Fluffy_Pillow 242484.7/1100000: 22% mana | 3.0/5: 60% soul_shard tormented_souls(4), active_uas, devils_due, accelerando
2:07.801 default M unstable_affliction Fluffy_Pillow 262105.8/1100000: 24% mana | 2.0/5: 40% soul_shard tormented_souls(4), active_uas(2), accelerando
2:09.053 default D soul_harvest Fluffy_Pillow 278637.2/1100000: 25% mana | 1.0/5: 20% soul_shard tormented_souls(4), active_uas(3), accelerando
2:09.053 default E potion Fluffy_Pillow 278637.2/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(4), active_uas(3), accelerando
2:09.053 default N reap_souls Fluffy_Pillow 278637.2/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls(4), active_uas(3), accelerando, potion_of_prolonged_power
2:09.053 default Q drain_soul Fluffy_Pillow 278637.2/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
2:16.026 default H life_tap Fluffy_Pillow 106708.7/1100000: 10% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), accelerando, potion_of_prolonged_power
2:17.279 default I corruption Fluffy_Pillow 453251.7/1100000: 41% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), accelerando, potion_of_prolonged_power
2:18.533 default Q drain_soul Fluffy_Pillow 436809.5/1100000: 40% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), accelerando, potion_of_prolonged_power
2:20.392 default G agony Fluffy_Pillow 395355.7/1100000: 36% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(3), accelerando, potion_of_prolonged_power
2:21.644 default M unstable_affliction Fluffy_Pillow 378887.1/1100000: 34% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(4), accelerando, potion_of_prolonged_power
2:22.898 default M unstable_affliction Fluffy_Pillow 395444.9/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls, active_uas, accelerando, potion_of_prolonged_power
2:24.151 default M unstable_affliction Fluffy_Pillow 411989.6/1100000: 37% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls, active_uas(2), accelerando, potion_of_prolonged_power
2:25.403 default Q drain_soul Fluffy_Pillow 428579.3/1100000: 39% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls, active_uas(3), accelerando(2), potion_of_prolonged_power
2:29.720 default N reap_souls Fluffy_Pillow 321337.6/1100000: 29% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas(2), potion_of_prolonged_power
2:29.720 default Q drain_soul Fluffy_Pillow 321337.6/1100000: 29% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), potion_of_prolonged_power
2:31.712 default J corruption Fluffy_Pillow 281450.2/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando, potion_of_prolonged_power
2:32.966 default Q drain_soul Fluffy_Pillow 265008.0/1100000: 24% mana | 1.0/5: 20% soul_shard deadwind_harvester, accelerando, potion_of_prolonged_power
2:37.387 default G agony Fluffy_Pillow 159245.1/1100000: 14% mana | 1.0/5: 20% soul_shard deadwind_harvester, accelerando(3), potion_of_prolonged_power
2:38.599 default M unstable_affliction Fluffy_Pillow 142791.9/1100000: 13% mana | 1.0/5: 20% soul_shard deadwind_harvester, accelerando(3), potion_of_prolonged_power
2:39.812 default Q drain_soul Fluffy_Pillow 159352.4/1100000: 14% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas, accelerando(3), potion_of_prolonged_power
2:41.732 default Q drain_soul Fluffy_Pillow 119982.5/1100000: 11% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, active_uas, accelerando(5), potion_of_prolonged_power
2:43.549 default H life_tap Fluffy_Pillow 78502.8/1100000: 7% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror, active_uas, potion_of_prolonged_power
2:44.825 default Q drain_soul Fluffy_Pillow 425065.2/1100000: 39% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror, active_uas, potion_of_prolonged_power
2:46.763 default I corruption Fluffy_Pillow 384464.7/1100000: 35% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror(2), accelerando, potion_of_prolonged_power
2:48.016 default M unstable_affliction Fluffy_Pillow 368009.3/1100000: 33% mana | 1.0/5: 20% soul_shard tormented_souls(2), compounding_horror(2), accelerando, potion_of_prolonged_power
2:49.269 default O reap_souls Fluffy_Pillow 384554.8/1100000: 35% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas, accelerando(2), potion_of_prolonged_power
2:49.269 default Q drain_soul Fluffy_Pillow 384554.8/1100000: 35% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando(2), potion_of_prolonged_power
2:55.991 default G agony Fluffy_Pillow 210820.5/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), accelerando(2), potion_of_prolonged_power
2:57.224 default Q drain_soul Fluffy_Pillow 194377.7/1100000: 18% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(3), accelerando(2), potion_of_prolonged_power
2:59.878 default I corruption Fluffy_Pillow 130027.3/1100000: 12% mana | 2.0/5: 40% soul_shard compounding_horror(4), nefarious_pact, potion_of_prolonged_power
3:00.751 default H life_tap Fluffy_Pillow 108358.7/1100000: 10% mana | 2.0/5: 40% soul_shard compounding_horror(5), nefarious_pact, potion_of_prolonged_power
3:01.624 default M unstable_affliction Fluffy_Pillow 449725.1/1100000: 41% mana | 2.0/5: 40% soul_shard compounding_horror(5), nefarious_pact, accelerando, potion_of_prolonged_power
3:02.481 default M unstable_affliction Fluffy_Pillow 461040.9/1100000: 42% mana | 1.0/5: 20% soul_shard active_uas, nefarious_pact, accelerando, potion_of_prolonged_power
3:03.339 default M unstable_affliction Fluffy_Pillow 472370.0/1100000: 43% mana | 1.0/5: 20% soul_shard active_uas(2), nefarious_pact, accelerando, potion_of_prolonged_power
3:04.198 default Q drain_soul Fluffy_Pillow 483712.2/1100000: 44% mana | 1.0/5: 20% soul_shard active_uas(3), nefarious_pact, accelerando, potion_of_prolonged_power
3:13.242 default G agony Fluffy_Pillow 141407.8/1100000: 13% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, devils_due, accelerando(2)
3:14.704 default I corruption Fluffy_Pillow 127485.8/1100000: 12% mana | 1.0/5: 20% soul_shard tormented_souls, compounding_horror, devils_due
3:16.217 default M unstable_affliction Fluffy_Pillow 114463.4/1100000: 10% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror, devils_due, accelerando
3:17.705 default M unstable_affliction Fluffy_Pillow 134201.4/1100000: 12% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas, accelerando(2)
3:18.937 default N reap_souls Fluffy_Pillow 150746.1/1100000: 14% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(2), accelerando(3)
3:18.937 default Q drain_soul Fluffy_Pillow 150746.1/1100000: 14% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(3)
3:20.845 default Q drain_soul Fluffy_Pillow 110795.1/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas(2), accelerando(3)
3:22.844 default H life_tap Fluffy_Pillow 72086.4/1100000: 7% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas(2), accelerando(3)
3:24.055 default N reap_souls Fluffy_Pillow 418619.6/1100000: 38% mana | 0.0/5: 0% soul_shard tormented_souls, compounding_horror, active_uas(2), accelerando(3)
3:24.055 default Q drain_soul Fluffy_Pillow 418619.6/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas(2), accelerando(3)
3:27.523 default I corruption Fluffy_Pillow 333415.6/1100000: 30% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2)
3:28.799 default Q drain_soul Fluffy_Pillow 316996.3/1100000: 29% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(3), accelerando
3:31.544 default G agony Fluffy_Pillow 254432.9/1100000: 23% mana | 1.0/5: 20% soul_shard compounding_horror(3), accelerando(2)
3:32.774 default M unstable_affliction Fluffy_Pillow 237949.8/1100000: 22% mana | 1.0/5: 20% soul_shard compounding_horror(3), accelerando(2)
3:34.007 default Q drain_soul Fluffy_Pillow 254507.0/1100000: 23% mana | 0.0/5: 0% soul_shard active_uas, accelerando(2)
3:39.962 default H life_tap Fluffy_Pillow 103890.0/1100000: 9% mana | 1.0/5: 20% soul_shard compounding_horror, active_uas, accelerando(3)
3:41.175 default I corruption Fluffy_Pillow 450249.3/1100000: 41% mana | 1.0/5: 20% soul_shard compounding_horror(2)
3:42.450 default M unstable_affliction Fluffy_Pillow 434084.4/1100000: 39% mana | 1.0/5: 20% soul_shard compounding_horror(2), accelerando
3:43.705 default Q drain_soul Fluffy_Pillow 450697.6/1100000: 41% mana | 0.0/5: 0% soul_shard active_uas, accelerando(2)
3:51.172 default G agony Fluffy_Pillow 256070.4/1100000: 23% mana | 1.0/5: 20% soul_shard tormented_souls, accelerando(5)
3:52.345 default Q drain_soul Fluffy_Pillow 239610.5/1100000: 22% mana | 1.0/5: 20% soul_shard tormented_souls, accelerando(5)
3:55.659 default I corruption Fluffy_Pillow 151691.5/1100000: 14% mana | 2.0/5: 40% soul_shard tormented_souls, accelerando
3:56.911 default M unstable_affliction Fluffy_Pillow 135222.9/1100000: 12% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror, accelerando
3:58.164 default M unstable_affliction Fluffy_Pillow 151767.5/1100000: 14% mana | 1.0/5: 20% soul_shard tormented_souls, active_uas, accelerando
3:59.419 default N reap_souls Fluffy_Pillow 168338.5/1100000: 15% mana | 0.0/5: 0% soul_shard tormented_souls(2), active_uas(2), accelerando
3:59.419 default Q drain_soul Fluffy_Pillow 168338.5/1100000: 15% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando
4:01.342 default Q drain_soul Fluffy_Pillow 127729.8/1100000: 12% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando
4:03.279 default H life_tap Fluffy_Pillow 87649.7/1100000: 8% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(2)
4:04.514 default Q drain_soul Fluffy_Pillow 434233.8/1100000: 39% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, active_uas(2), accelerando(2)
4:07.302 default G agony Fluffy_Pillow 372793.1/1100000: 34% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror
4:08.576 default Q drain_soul Fluffy_Pillow 356329.5/1100000: 32% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror
4:10.606 default I corruption Fluffy_Pillow 316678.6/1100000: 29% mana | 1.0/5: 20% soul_shard compounding_horror
4:11.880 default M unstable_affliction Fluffy_Pillow 300215.0/1100000: 27% mana | 2.0/5: 40% soul_shard compounding_horror(2)
4:13.155 default M unstable_affliction Fluffy_Pillow 316764.4/1100000: 29% mana | 1.0/5: 20% soul_shard active_uas
4:14.430 default M unstable_affliction Fluffy_Pillow 333313.8/1100000: 30% mana | 1.0/5: 20% soul_shard active_uas(2)
4:15.705 default D soul_harvest Fluffy_Pillow 349863.1/1100000: 32% mana | 0.0/5: 0% soul_shard tormented_souls, active_uas(3)
4:15.705 default N reap_souls Fluffy_Pillow 349863.1/1100000: 32% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls, active_uas(3)
4:15.705 default Q drain_soul Fluffy_Pillow 349863.1/1100000: 32% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(3)
4:23.488 default I corruption Fluffy_Pillow 157162.0/1100000: 14% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, compounding_horror, accelerando(3)
4:24.700 default G agony Fluffy_Pillow 140708.9/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, compounding_horror, accelerando(3)
4:25.913 default M unstable_affliction Fluffy_Pillow 124269.3/1100000: 11% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, compounding_horror, accelerando(3)
4:27.128 default M unstable_affliction Fluffy_Pillow 140857.1/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, active_uas, accelerando(3)
4:28.342 default N reap_souls Fluffy_Pillow 157281.9/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, tormented_souls, active_uas(2)
4:28.342 default Q drain_soul Fluffy_Pillow 157281.9/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, active_uas(2)
4:30.246 default Q drain_soul Fluffy_Pillow 115995.6/1100000: 11% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, compounding_horror(2), active_uas(2)
4:32.188 default H life_tap Fluffy_Pillow 75202.6/1100000: 7% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, compounding_horror(2), active_uas(2)
4:33.463 default K unstable_affliction Fluffy_Pillow 421796.3/1100000: 38% mana | 1.0/5: 20% soul_shard compounding_horror(4), active_uas(2), accelerando
4:34.714 default Q drain_soul Fluffy_Pillow 438314.5/1100000: 40% mana | 0.0/5: 0% soul_shard active_uas(2), accelerando
4:37.509 default J corruption Fluffy_Pillow 376219.7/1100000: 34% mana | 0.0/5: 0% soul_shard tormented_souls, compounding_horror, active_uas, accelerando
4:38.763 default Q drain_soul Fluffy_Pillow 359777.5/1100000: 33% mana | 0.0/5: 0% soul_shard tormented_souls, compounding_horror, active_uas, accelerando
4:43.145 default G agony Fluffy_Pillow 253072.3/1100000: 23% mana | 0.0/5: 0% soul_shard tormented_souls(3), compounding_horror(2), accelerando(2)
4:44.376 default Q drain_soul Fluffy_Pillow 236602.7/1100000: 22% mana | 0.0/5: 0% soul_shard tormented_souls(3), compounding_horror(2), accelerando(2)
4:46.203 default B reap_souls Fluffy_Pillow 194731.3/1100000: 18% mana | 0.0/5: 0% soul_shard tormented_souls(3), compounding_horror(2)
4:46.203 default Q drain_soul Fluffy_Pillow 194731.3/1100000: 18% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror(2)
4:49.805 default Q drain_soul Fluffy_Pillow 110217.3/1100000: 10% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando
4:51.671 default I corruption Fluffy_Pillow 68855.9/1100000: 6% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), accelerando
4:52.925 default P life_tap Fluffy_Pillow 52432.6/1100000: 5% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), accelerando(2)
4:54.157 default K unstable_affliction Fluffy_Pillow 398976.4/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), accelerando(2)
4:55.390 default K unstable_affliction Fluffy_Pillow 415533.6/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(2)
4:56.622 default Q drain_soul Fluffy_Pillow 432077.4/1100000: 39% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), accelerando(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 56169 56169 35271
Intellect 50513 48806 39155 (1278)
Spirit 0 0 0
Health 3370140 3370140 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50513 48806 0
Crit 23.14% 23.14% 7255
Haste 18.00% 18.00% 5882
Damage / Heal Versatility 2.33% 2.33% 1107
ManaReg per Second 12980 12980 0
Mastery 115.03% 112.03% 11140
Armor 1983 1983 1983
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 910.00
Local Head Eyes of Azj'Aqir
ilevel: 905, stats: { 257 Armor, +3410 Sta, +2273 Int, +1094 Haste, +589 Vers }
Local Neck Beleron's Choker of Misery
ilevel: 905, stats: { +1918 Sta, +1727 Crit, +1295 Mastery }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Master Warmage's Leggings
ilevel: 905, stats: { 277 Armor, +3410 Sta, +2273 Int, +914 Mastery, +769 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Bracers of Harnessed Flame
ilevel: 905, stats: { 139 Armor, +1918 Sta, +1278 Int, +595 Mastery, +351 Crit }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Sephuz's Secret
ilevel: 940, stats: { +2658 Sta, +1068 Haste, +2671 Crit }, gems: { +150 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Temporal Recalibration
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +636 Mastery, +311 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Sephuzs_Secret"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3518
neck=belerons_choker_of_misery,id=140899,bonus_id=3518,enchant=mark_of_the_trained_soldier
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518
back=cloak_of_temporal_recalibration,id=140910,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3518
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518
legs=master_warmages_leggings,id=140852,bonus_id=3518
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=sephuzs_secret,id=132452,ilevel=940,gems=150mastery,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=erratic_metronome,id=140792,bonus_id=3445
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=909.60
# gear_stamina=35271
# gear_intellect=39155
# gear_crit_rating=7113
# gear_haste_rating=5767
# gear_mastery_rating=10922
# gear_versatility_rating=1085
# gear_armor=1983
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Sindorei_Spite : 926060 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
926060.2 926060.2 1458.3 / 0.157% 207063.3 / 22.4% 29.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
28466.0 28466.0 Mana 0.00% 32.5 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sindorei_Spite 926060
Agony 134199 14.5% 17.3 18.09sec 2327755 1903502 Periodic 190.8 141659 375707 210765 29.5% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.28 0.00 190.82 190.82 1.2229 1.5677 40219086.05 40219086.05 0.00 125571.63 1903501.64
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 134.5 70.47% 141658.84 14997 265733 141712.95 118302 159642 19049969 19049969 0.00
crit 56.3 29.53% 375707.47 34792 701535 375769.69 292580 444164 21169117 21169117 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 6533 0.7% 25.1 11.78sec 77964 0 Direct 25.1 63605 127268 77962 22.6%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.11 25.11 0.00 0.00 0.0000 0.0000 1957749.72 1957749.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.45 77.45% 63605.01 19880 220180 63845.08 34684 108437 1236976 1236976 0.00
crit 5.66 22.55% 127267.68 39759 440359 127418.20 0 373186 720773 720773 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 117489 12.7% 21.9 13.85sec 1604844 1342702 Periodic 190.5 124481 328758 184853 29.6% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 0.00 190.46 190.46 1.1952 1.5637 35208323.50 35208323.50 0.00 108647.55 1342701.68
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 134.2 70.44% 124480.54 363 228142 124565.71 109534 138860 16701705 16701705 0.00
crit 56.3 29.56% 328758.11 2190 602295 328841.20 265570 393321 18506618 18506618 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 120872 13.1% 64.8 4.59sec 559321 197447 Periodic 219.6 126600 255681 164971 29.7% 57.0%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.76 0.00 219.57 219.57 2.8328 0.7788 36223417.78 36223417.78 0.00 197446.94 197446.94
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 154.3 70.27% 126600.21 79023 184954 126708.16 115831 136490 19534203 19534203 0.00
crit 65.3 29.73% 255681.47 158046 369907 255841.91 221689 280433 16689214 16689214 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 24978 2.7% 49.9 5.87sec 149900 0 Direct 49.7 123139 246046 150599 22.3%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.94 49.70 0.00 0.00 0.0000 0.0000 7485339.72 7485339.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.60 77.66% 123138.59 80762 178898 123179.96 110563 139383 4752787 4752787 0.00
crit 11.11 22.34% 246046.08 161524 357797 246077.20 182300 342241 2732553 2732553 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Soul 19195 2.1% 16.1 17.55sec 358143 0 Direct 16.1 292219 585930 358138 22.4%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.07 16.07 0.00 0.00 0.0000 0.0000 5753714.07 5753714.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.46 77.55% 292219.06 186372 412837 292019.15 195958 374944 3640892 3640892 0.00
crit 3.61 22.45% 585930.40 372743 825673 567497.83 0 825673 2112822 2112822 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (420933) 0.0% (45.4%) 46.2 6.48sec 2728206 2317430

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.20 0.00 0.00 0.00 1.1773 0.0000 0.00 0.00 0.00 2317429.79 2317429.79
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 189472 20.5% 0.0 0.00sec 0 0 Periodic 108.4 311392 830645 524083 41.0% 50.5%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 108.37 108.37 0.0000 1.3981 56795060.05 56795060.05 0.00 374852.72 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.0 59.04% 311391.70 582 538576 312001.93 252297 376566 19922850 19922850 0.00
crit 44.4 40.96% 830645.41 1351 1421841 831859.59 633628 1055537 36872210 36872210 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 145560 15.7% 0.0 0.00sec 0 0 Periodic 77.7 331488 883098 560958 41.6% 35.7%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 77.72 77.72 0.0000 1.3789 43594404.24 43594404.24 0.00 406816.02 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.4 58.40% 331488.06 206 538576 332628.04 260918 409241 15044844 15044844 0.00
crit 32.3 41.60% 883097.75 1351 1421841 885531.74 605722 1143400 28549560 28549560 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 80076 8.6% 0.0 0.00sec 0 0 Periodic 41.1 344252 917329 582064 41.5% 18.4%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 41.07 41.07 0.0000 1.3409 23906679.83 23906679.83 0.00 434098.63 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.0 58.50% 344251.83 584 538576 349007.08 244999 538576 8271635 8271635 0.00
crit 17.0 41.50% 917329.17 980 1421841 929573.91 145339 1421841 15635044 15635044 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 5053 0.5% 0.0 0.00sec 0 0 Periodic 2.9 309663 824316 522372 41.3% 1.3%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 2.88 2.88 0.0000 1.3832 1507124.78 1507124.78 0.00 377725.51 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.7 58.66% 309663.30 582 538576 136160.23 0 538576 523931 523931 0.00
crit 1.2 41.34% 824315.73 5326 1421841 343800.83 0 1421841 983194 983194 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 772 0.1% 0.0 0.00sec 0 0 Periodic 0.5 294043 791328 505946 42.6% 0.2%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.45 0.45 0.0000 1.3900 230150.45 230150.45 0.00 364162.11 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 57.39% 294042.53 3031 538576 25505.97 0 538576 76760 76760 0.00
crit 0.2 42.61% 791327.77 3888 1421841 64913.14 0 1421841 153390 153390 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 81860 / 81860
Doom Bolt 81860 8.8% 122.6 2.43sec 200062 84211 Direct 121.8 164374 328725 201353 22.5%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.64 121.85 0.00 0.00 2.3757 0.0000 24535311.75 24535311.75 0.00 84211.05 84211.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 94.43 77.50% 164373.96 132693 264048 164469.51 154906 172816 15521943 15521943 0.00
crit 27.42 22.50% 328725.17 265385 528097 328919.10 296348 376101 9013369 9013369 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Sindorei_Spite
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sindorei_Spite
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sindorei_Spite
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sindorei_Spite
  • harmful:false
  • if_expr:
 
Life Tap 11.3 23.02sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.25 0.00 0.00 0.00 1.2144 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 1.9 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 12.3 25.21sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.30 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.2 159.00sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.25 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 2.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.6240 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.9 0.0 15.5sec 15.5sec 77.90% 77.90% 2.1(2.1) 19.1

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.12%
  • accelerando_2:23.56%
  • accelerando_3:14.46%
  • accelerando_4:6.91%
  • accelerando_5:3.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 22.5 23.7 13.5sec 0.0sec 55.49% 55.49% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:29.73%
  • active_uas_2:16.79%
  • active_uas_3:8.75%
  • active_uas_4:0.17%
  • active_uas_5:0.04%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 27.3 39.3 10.9sec 4.4sec 61.76% 100.00% 2.3(2.3) 1.6

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:25.78%
  • compounding_horror_2:16.84%
  • compounding_horror_3:10.00%
  • compounding_horror_4:5.13%
  • compounding_horror_5:4.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 12.3 0.0 25.0sec 25.0sec 74.37% 74.37% 0.0(0.0) 11.4

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:74.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 68.9sec 68.9sec 8.69% 8.69% 0.0(0.0) 3.2

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.69%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.4 0.0 69.2sec 68.7sec 13.52% 13.52% 0.0(0.0) 3.3

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.52%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 1.9 0.0 169.2sec 0.0sec 37.73% 37.73% 0.0(0.0) 1.8

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:37.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Sin'dorei Spite 2.0 0.0 180.7sec 0.0sec 16.89% 16.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_sindorei_spite
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • sindorei_spite_1:16.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208871
  • name:Sin'dorei Spite
  • tooltip:You and your minions deal {$s1=15}% increased damage.
  • description:{$@spelldesc208868=For {$208871d=25 seconds} after casting Summon Doomguard or Summon Infernal, you and your minions deal {$208871s1=15}% increased damage.{$?s152107=false}[ This effect can be gained only once every {$242690d=180 seconds}.][]}
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:0.00%
Soul Harvest 2.2 0.0 158.2sec 158.2sec 12.61% 12.61% 0.0(0.0) 2.2

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:12.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 13.0 34.9 23.9sec 6.6sec 76.53% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:22.51%
  • tormented_souls_2:18.45%
  • tormented_souls_3:13.81%
  • tormented_souls_4:9.62%
  • tormented_souls_5:5.82%
  • tormented_souls_6:3.34%
  • tormented_souls_7:1.83%
  • tormented_souls_8:0.65%
  • tormented_souls_9:0.28%
  • tormented_souls_10:0.12%
  • tormented_souls_11:0.06%
  • tormented_souls_12:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 5.8 42.4sec
t18_2pc_affliction 46.2 6.5sec
soul_conduit 9.4 28.4sec
souls_consumed 46.1 25.0sec

Resources

Resource Usage Type Count Total Average RPE APR
Sindorei_Spite
agony Mana 17.3 570168.5 33000.0 32999.6 70.5
corruption Mana 21.9 723981.6 33000.0 33000.1 48.6
drain_soul Mana 219.6 7246075.8 33000.0 111885.8 5.0
summon_doomguard Soul Shard 2.0 1.0 0.5 0.5 0.0
unstable_affliction Soul Shard 46.2 46.2 1.0 1.0 2728180.2
pet - doomguard
doom_bolt Energy 122.6 4292.4 35.0 35.0 5716.0
Resource Gains Type Count Total Average Overflow
life_tap Mana 11.25 3712780.33 (48.14%) 330000.00 0.00 0.00%
agony Soul Shard 35.09 35.09 (77.87%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.58 0.58 (1.29%) 1.00 0.00 0.00%
mp5_regen Mana 347.61 3999120.71 (51.86%) 11504.62 22033.80 0.55%
soul_conduit Soul Shard 9.39 9.39 (20.84%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 196.90 4250.83 (100.00%) 21.59 118.92 2.72%
Resource RPS-Gain RPS-Loss
Health 0.00 12853.72
Mana 25704.79 28465.96
Soul Shard 0.15 0.16
Combat End Resource Mean Min Max
Mana 275917.42 52117.93 485400.41
Soul Shard 0.86 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Sindorei_Spite Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Sindorei_Spite Damage Per Second
Count 4999
Mean 926060.16
Minimum 771628.61
Maximum 1139123.88
Spread ( max - min ) 367495.27
Range [ ( max - min ) / 2 * 100% ] 19.84%
Standard Deviation 52605.0560
5th Percentile 842037.80
95th Percentile 1014415.41
( 95th Percentile - 5th Percentile ) 172377.61
Mean Distribution
Standard Deviation 744.0222
95.00% Confidence Intervall ( 924601.90 - 927518.42 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 124
0.1% Error 12396
0.1 Scale Factor Error with Delta=300 23623196
0.05 Scale Factor Error with Delta=300 94492782
0.01 Scale Factor Error with Delta=300 2362319549
Priority Target DPS
Sample Data Sindorei_Spite Priority Target Damage Per Second
Count 4999
Mean 926060.16
Minimum 771628.61
Maximum 1139123.88
Spread ( max - min ) 367495.27
Range [ ( max - min ) / 2 * 100% ] 19.84%
Standard Deviation 52605.0560
5th Percentile 842037.80
95th Percentile 1014415.41
( 95th Percentile - 5th Percentile ) 172377.61
Mean Distribution
Standard Deviation 744.0222
95.00% Confidence Intervall ( 924601.90 - 927518.42 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 124
0.1% Error 12396
0.1 Scale Factor Error with Delta=300 23623196
0.05 Scale Factor Error with Delta=300 94492782
0.01 Scale Factor Error with Delta=300 2362319549
DPS(e)
Sample Data Sindorei_Spite Damage Per Second (Effective)
Count 4999
Mean 926060.16
Minimum 771628.61
Maximum 1139123.88
Spread ( max - min ) 367495.27
Range [ ( max - min ) / 2 * 100% ] 19.84%
Damage
Sample Data Sindorei_Spite Damage
Count 4999
Mean 252881050.18
Minimum 175134301.80
Maximum 342680138.48
Spread ( max - min ) 167545836.68
Range [ ( max - min ) / 2 * 100% ] 33.13%
DTPS
Sample Data Sindorei_Spite Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sindorei_Spite Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sindorei_Spite Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sindorei_Spite Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sindorei_Spite Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sindorei_Spite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Sindorei_SpiteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Sindorei_Spite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 1.50 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 4.56 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
D 1.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
E 2.25 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 0.95 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
G 1.00 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
H 12.72 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
I 10.64 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
J 14.36 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
K 6.58 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
L 5.68 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
M 1.53 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
N 39.17 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
O 8.36 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
P 2.43 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
Q 0.61 life_tap,if=mana.pct<=10
R 49.23 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACJNNNEORJRHNNNRORJRHNLNRKRNPRCJNNNRIRHJNNNRBRJIHNNRJRHNRIKNRNRHJNRNORIRJHNRNRIKNRHRIJNNORCRDGNRIRHJNNRORJRHINNRKRHNBRRIKNNRHJNRNRIRHJNNRBRJLLRLCEFRRKLQR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Sindorei_Spite 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Sindorei_Spite 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard sindorei_spite
Pre precombat 6 augmentation Sindorei_Spite 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard sindorei_spite
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard sindorei_spite, potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard sindorei_spite, potion_of_prolonged_power
0:01.322 default J corruption Fluffy_Pillow 1088896.6/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, sindorei_spite, accelerando, potion_of_prolonged_power
0:02.323 default N unstable_affliction Fluffy_Pillow 1072476.3/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, sindorei_spite, accelerando, potion_of_prolonged_power
0:03.324 default N unstable_affliction Fluffy_Pillow 1089056.1/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, active_uas, sindorei_spite, accelerando, potion_of_prolonged_power
0:04.323 default N unstable_affliction Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), sindorei_spite, accelerando(2), potion_of_prolonged_power
0:05.305 default E soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(3), sindorei_spite, accelerando(2), potion_of_prolonged_power
0:05.305 default O reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, active_uas(3), sindorei_spite, accelerando(2), potion_of_prolonged_power
0:05.305 default R drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), sindorei_spite, accelerando(2), potion_of_prolonged_power
0:11.333 default J corruption Fluffy_Pillow 904796.7/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), sindorei_spite, accelerando(3), potion_of_prolonged_power
0:12.298 default R drain_soul Fluffy_Pillow 888076.1/1100000: 81% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), sindorei_spite, potion_of_prolonged_power
0:14.002 default H agony Fluffy_Pillow 850107.0/1100000: 77% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), sindorei_spite, accelerando, potion_of_prolonged_power
0:15.003 default N unstable_affliction Fluffy_Pillow 833686.8/1100000: 76% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), sindorei_spite, accelerando, potion_of_prolonged_power
0:16.004 default N unstable_affliction Fluffy_Pillow 850266.6/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas, sindorei_spite, accelerando, potion_of_prolonged_power
0:17.005 default N unstable_affliction Fluffy_Pillow 866846.3/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, active_uas(2), sindorei_spite, accelerando, potion_of_prolonged_power
0:18.006 default R drain_soul Fluffy_Pillow 883426.1/1100000: 80% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls(3), active_uas(3), sindorei_spite, accelerando, potion_of_prolonged_power
0:21.010 default O reap_souls Fluffy_Pillow 801568.7/1100000: 73% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, tormented_souls(4), compounding_horror, active_uas(2), sindorei_spite, accelerando(2), potion_of_prolonged_power
0:21.010 default R drain_soul Fluffy_Pillow 801568.7/1100000: 73% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, compounding_horror, active_uas(2), sindorei_spite, accelerando(2), potion_of_prolonged_power
0:25.823 default J corruption Fluffy_Pillow 651176.6/1100000: 59% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls(2), compounding_horror(5), potion_of_prolonged_power
0:26.841 default R drain_soul Fluffy_Pillow 634763.8/1100000: 58% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls(2), compounding_horror(5), accelerando, potion_of_prolonged_power
0:31.642 default H agony Fluffy_Pillow 483283.8/1100000: 44% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, tormented_souls(3), compounding_horror(5), accelerando, potion_of_prolonged_power
0:32.641 default N unstable_affliction Fluffy_Pillow 466830.4/1100000: 42% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, tormented_souls(3), compounding_horror(5), accelerando, potion_of_prolonged_power
0:33.642 default L unstable_affliction Fluffy_Pillow 483410.2/1100000: 44% mana | 4.0/5: 80% soul_shard bloodlust, deadwind_harvester, tormented_souls(3), active_uas, accelerando, potion_of_prolonged_power
0:34.644 default N unstable_affliction Fluffy_Pillow 500006.5/1100000: 45% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, tormented_souls(4), active_uas(2), accelerando, potion_of_prolonged_power
0:35.644 default R drain_soul Fluffy_Pillow 516569.7/1100000: 47% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls(4), active_uas(3), accelerando, potion_of_prolonged_power
0:40.509 default K corruption Fluffy_Pillow 366193.5/1100000: 33% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, tormented_souls(7), compounding_horror(3), active_uas, potion_of_prolonged_power
0:41.528 default R drain_soul Fluffy_Pillow 345952.6/1100000: 31% mana | 3.0/5: 60% soul_shard tormented_souls(7), compounding_horror(3), potion_of_prolonged_power
0:43.486 default N unstable_affliction Fluffy_Pillow 304469.2/1100000: 28% mana | 3.0/5: 60% soul_shard tormented_souls(7), compounding_horror(3), potion_of_prolonged_power
0:44.808 default P reap_souls Fluffy_Pillow 321022.2/1100000: 29% mana | 2.0/5: 40% soul_shard tormented_souls(7), active_uas, potion_of_prolonged_power
0:44.808 default R drain_soul Fluffy_Pillow 321022.2/1100000: 29% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas, potion_of_prolonged_power
0:51.967 default C agony Fluffy_Pillow 148174.4/1100000: 13% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:53.243 default J corruption Fluffy_Pillow 131712.1/1100000: 12% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(2), accelerando(2), potion_of_prolonged_power
0:54.521 default N unstable_affliction Fluffy_Pillow 115275.8/1100000: 10% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(3), accelerando(2), potion_of_prolonged_power
0:55.797 default N unstable_affliction Fluffy_Pillow 131813.6/1100000: 12% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), active_uas, accelerando(2), potion_of_prolonged_power
0:57.076 default N unstable_affliction Fluffy_Pillow 148422.1/1100000: 13% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), active_uas(2), accelerando(3), potion_of_prolonged_power
0:58.333 default R drain_soul Fluffy_Pillow 164842.8/1100000: 15% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), active_uas(3)
1:01.262 default I life_tap Fluffy_Pillow 102517.5/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), active_uas(3)
1:02.584 default R drain_soul Fluffy_Pillow 449167.7/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(6), active_uas(2), accelerando
1:07.122 default H agony Fluffy_Pillow 342966.4/1100000: 31% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(8), compounding_horror, accelerando(3)
1:08.377 default J corruption Fluffy_Pillow 326860.8/1100000: 30% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(8), compounding_horror(3), accelerando(5)
1:09.592 default N unstable_affliction Fluffy_Pillow 310408.8/1100000: 28% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(8), compounding_horror(3), accelerando(5)
1:10.806 default N unstable_affliction Fluffy_Pillow 326943.2/1100000: 30% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(8), active_uas, accelerando(5)
1:12.022 default N unstable_affliction Fluffy_Pillow 343504.8/1100000: 31% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(8), active_uas(2), accelerando(5)
1:13.237 default R drain_soul Fluffy_Pillow 360052.8/1100000: 33% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(8), active_uas(3), accelerando(5)
1:20.876 default B reap_souls Fluffy_Pillow 163253.2/1100000: 15% mana | 1.0/5: 20% soul_shard tormented_souls(9), compounding_horror, accelerando(5)
1:20.876 default R drain_soul Fluffy_Pillow 163253.2/1100000: 15% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, accelerando(5)
1:22.664 default J corruption Fluffy_Pillow 121605.4/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, accelerando(5)
1:23.879 default I life_tap Fluffy_Pillow 105153.4/1100000: 10% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), accelerando(5)
1:25.096 default H agony Fluffy_Pillow 451728.6/1100000: 41% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(2), accelerando(5)
1:26.311 default N unstable_affliction Fluffy_Pillow 435276.6/1100000: 40% mana | 2.0/5: 40% soul_shard deadwind_harvester, compounding_horror(3), accelerando(5)
1:27.527 default N unstable_affliction Fluffy_Pillow 451838.3/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(5)
1:28.743 default R drain_soul Fluffy_Pillow 467878.1/1100000: 43% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2)
1:36.055 default J corruption Fluffy_Pillow 297830.3/1100000: 27% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(3)
1:37.312 default R drain_soul Fluffy_Pillow 281398.0/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(3)
1:43.442 default H agony Fluffy_Pillow 132045.5/1100000: 12% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(4)
1:44.763 default N unstable_affliction Fluffy_Pillow 115586.1/1100000: 11% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5)
1:46.085 default R drain_soul Fluffy_Pillow 132251.6/1100000: 12% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando
1:48.053 default I life_tap Fluffy_Pillow 91325.8/1100000: 8% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando
1:49.351 default K corruption Fluffy_Pillow 437928.3/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(2)
1:50.629 default N unstable_affliction Fluffy_Pillow 421492.0/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando(2)
1:51.907 default R drain_soul Fluffy_Pillow 438302.9/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), accelerando(3)
1:53.864 default N unstable_affliction Fluffy_Pillow 398096.8/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas, accelerando(3)
1:55.119 default R drain_soul Fluffy_Pillow 414721.9/1100000: 38% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), accelerando(4)
2:02.090 default H agony Fluffy_Pillow 241375.5/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), accelerando(3)
2:03.345 default J corruption Fluffy_Pillow 224916.8/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), accelerando(3)
2:04.601 default N unstable_affliction Fluffy_Pillow 208471.3/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(4), accelerando(3)
2:05.857 default R drain_soul Fluffy_Pillow 225025.8/1100000: 20% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(5), active_uas, accelerando(3)
2:09.425 default N unstable_affliction Fluffy_Pillow 140053.3/1100000: 13% mana | 1.0/5: 20% soul_shard tormented_souls(5), active_uas, accelerando(3)
2:10.679 default O reap_souls Fluffy_Pillow 156581.5/1100000: 14% mana | 0.0/5: 0% soul_shard tormented_souls(5), active_uas(2), accelerando(3)
2:10.679 default R drain_soul Fluffy_Pillow 156581.5/1100000: 14% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(3)
2:13.450 default I life_tap Fluffy_Pillow 93223.0/1100000: 8% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas, accelerando(2)
2:14.729 default R drain_soul Fluffy_Pillow 439799.6/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas, accelerando(2)
2:17.574 default J corruption Fluffy_Pillow 377672.6/1100000: 34% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, accelerando(2)
2:18.853 default H agony Fluffy_Pillow 361357.2/1100000: 33% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, accelerando(3)
2:20.109 default N unstable_affliction Fluffy_Pillow 345198.6/1100000: 31% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, accelerando(5)
2:21.324 default R drain_soul Fluffy_Pillow 361746.6/1100000: 33% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas, accelerando(5)
2:27.245 default N unstable_affliction Fluffy_Pillow 207952.8/1100000: 19% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), active_uas, nefarious_pact, accelerando
2:28.133 default R drain_soul Fluffy_Pillow 219266.7/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas, nefarious_pact, accelerando
2:31.239 default I life_tap Fluffy_Pillow 94374.0/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), active_uas, nefarious_pact, accelerando(3)
2:32.097 default K corruption Fluffy_Pillow 435858.5/1100000: 40% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), active_uas, nefarious_pact, accelerando(4)
2:32.943 default N unstable_affliction Fluffy_Pillow 414194.9/1100000: 38% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), nefarious_pact, accelerando(4)
2:33.787 default R drain_soul Fluffy_Pillow 425504.6/1100000: 39% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), active_uas, nefarious_pact, accelerando(4)
2:38.543 default H agony Fluffy_Pillow 223199.0/1100000: 20% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror, nefarious_pact
2:39.448 default R drain_soul Fluffy_Pillow 201729.5/1100000: 18% mana | 1.0/5: 20% soul_shard tormented_souls(5), compounding_horror, devils_due, accelerando
2:44.842 default I life_tap Fluffy_Pillow 106759.6/1100000: 10% mana | 2.0/5: 40% soul_shard tormented_souls(6), compounding_horror, devils_due, accelerando(4)
2:46.308 default J corruption Fluffy_Pillow 456404.1/1100000: 41% mana | 2.0/5: 40% soul_shard tormented_souls(6), devils_due, accelerando(4)
2:47.772 default N unstable_affliction Fluffy_Pillow 443131.6/1100000: 40% mana | 2.0/5: 40% soul_shard tormented_souls(6), accelerando(5)
2:48.987 default N unstable_affliction Fluffy_Pillow 459679.6/1100000: 42% mana | 1.0/5: 20% soul_shard tormented_souls(6), active_uas, accelerando(5)
2:50.202 default O reap_souls Fluffy_Pillow 476227.6/1100000: 43% mana | 0.0/5: 0% soul_shard tormented_souls(6), active_uas(2), accelerando(5)
2:50.202 default R drain_soul Fluffy_Pillow 476227.6/1100000: 43% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2), accelerando(5)
2:57.035 default C agony Fluffy_Pillow 299188.0/1100000: 27% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando
2:58.336 default R drain_soul Fluffy_Pillow 282980.2/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(2)
3:00.254 default D summon_doomguard Fluffy_Pillow 242365.7/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(4)
3:01.487 default G corruption Fluffy_Pillow 258888.0/1100000: 24% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), sindorei_spite, accelerando(4)
3:02.724 default N unstable_affliction Fluffy_Pillow 242463.9/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), sindorei_spite, accelerando(4)
3:03.961 default R drain_soul Fluffy_Pillow 259238.8/1100000: 24% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas, sindorei_spite, accelerando(5)
3:09.897 default I life_tap Fluffy_Pillow 103948.3/1100000: 9% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, sindorei_spite, accelerando
3:11.195 default R drain_soul Fluffy_Pillow 450657.4/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, sindorei_spite, accelerando(2)
3:13.008 default H agony Fluffy_Pillow 408553.4/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, sindorei_spite, accelerando(3)
3:14.263 default J corruption Fluffy_Pillow 392094.7/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, sindorei_spite, accelerando(3)
3:15.520 default N unstable_affliction Fluffy_Pillow 375783.4/1100000: 34% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, sindorei_spite, accelerando(4)
3:16.755 default N unstable_affliction Fluffy_Pillow 392332.5/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), active_uas, sindorei_spite, accelerando(4)
3:17.992 default R drain_soul Fluffy_Pillow 408553.3/1100000: 37% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), sindorei_spite
3:20.877 default O reap_souls Fluffy_Pillow 345677.1/1100000: 31% mana | 1.0/5: 20% soul_shard tormented_souls(5), active_uas(2), sindorei_spite
3:20.877 default R drain_soul Fluffy_Pillow 345677.1/1100000: 31% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas(2), sindorei_spite
3:28.045 default J corruption Fluffy_Pillow 172095.2/1100000: 16% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(2), accelerando
3:29.346 default R drain_soul Fluffy_Pillow 155671.1/1100000: 14% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(2), accelerando
3:31.263 default H agony Fluffy_Pillow 114516.7/1100000: 10% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(4), accelerando(2)
3:32.540 default I life_tap Fluffy_Pillow 98067.4/1100000: 9% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(5), accelerando(2)
3:33.818 default N unstable_affliction Fluffy_Pillow 444808.0/1100000: 40% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(5), accelerando(3)
3:35.076 default N unstable_affliction Fluffy_Pillow 461388.8/1100000: 42% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(4), active_uas, accelerando(3)
3:36.329 default R drain_soul Fluffy_Pillow 477903.8/1100000: 43% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(4), active_uas(2), accelerando(3)
3:42.401 default K corruption Fluffy_Pillow 323384.2/1100000: 29% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(7), compounding_horror, active_uas
3:43.720 default R drain_soul Fluffy_Pillow 306899.7/1100000: 28% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(7), compounding_horror
3:50.119 default H agony Fluffy_Pillow 157379.3/1100000: 14% mana | 1.0/5: 20% soul_shard tormented_souls(7), compounding_horror, accelerando(2)
3:51.397 default N unstable_affliction Fluffy_Pillow 141002.7/1100000: 13% mana | 1.0/5: 20% soul_shard tormented_souls(8), accelerando(3)
3:52.654 default B reap_souls Fluffy_Pillow 157570.4/1100000: 14% mana | 1.0/5: 20% soul_shard tormented_souls(8), active_uas, accelerando(3)
3:52.654 default R drain_soul Fluffy_Pillow 157570.4/1100000: 14% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(3)
3:54.597 default R drain_soul Fluffy_Pillow 117179.8/1100000: 11% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(3)
3:56.411 default I life_tap Fluffy_Pillow 75089.0/1100000: 7% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(3)
3:57.667 default K corruption Fluffy_Pillow 421643.5/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(3)
3:58.922 default N unstable_affliction Fluffy_Pillow 405346.8/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror, active_uas
4:00.243 default N unstable_affliction Fluffy_Pillow 421887.3/1100000: 38% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas
4:01.566 default R drain_soul Fluffy_Pillow 438452.9/1100000: 40% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2)
4:08.045 default H agony Fluffy_Pillow 289721.9/1100000: 26% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), accelerando
4:09.344 default J corruption Fluffy_Pillow 273272.4/1100000: 25% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), accelerando
4:10.645 default N unstable_affliction Fluffy_Pillow 256848.3/1100000: 23% mana | 1.0/5: 20% soul_shard deadwind_harvester, compounding_horror(2), accelerando
4:11.943 default R drain_soul Fluffy_Pillow 273386.1/1100000: 25% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas, accelerando
4:13.968 default N unstable_affliction Fluffy_Pillow 233441.8/1100000: 21% mana | 1.0/5: 20% soul_shard deadwind_harvester, active_uas, accelerando(2)
4:15.247 default R drain_soul Fluffy_Pillow 249838.7/1100000: 23% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(2)
4:21.590 default I life_tap Fluffy_Pillow 100637.9/1100000: 9% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), active_uas, accelerando(2)
4:22.866 default R drain_soul Fluffy_Pillow 447175.6/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), accelerando(2)
4:24.869 default H agony Fluffy_Pillow 407135.8/1100000: 37% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), accelerando(2)
4:26.146 default J corruption Fluffy_Pillow 390686.5/1100000: 36% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(3), accelerando(2)
4:27.422 default N unstable_affliction Fluffy_Pillow 374198.4/1100000: 34% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(3)
4:28.744 default N unstable_affliction Fluffy_Pillow 390964.1/1100000: 36% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(5), active_uas, accelerando
4:30.043 default R drain_soul Fluffy_Pillow 407514.6/1100000: 37% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(5), active_uas(2), accelerando
4:33.657 default B reap_souls Fluffy_Pillow 322164.7/1100000: 29% mana | 0.0/5: 0% soul_shard tormented_souls(6), compounding_horror, active_uas(2), accelerando(2)
4:33.657 default R drain_soul Fluffy_Pillow 322164.7/1100000: 29% mana | 0.0/5: 0% soul_shard deadwind_harvester, compounding_horror, active_uas(2), accelerando(2)
4:37.341 default J corruption Fluffy_Pillow 237911.7/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(2)
4:38.619 default L unstable_affliction Fluffy_Pillow 221601.1/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror, accelerando(3)
4:39.875 default L unstable_affliction Fluffy_Pillow 238090.4/1100000: 22% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, active_uas
4:41.196 default R drain_soul Fluffy_Pillow 254630.9/1100000: 23% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas(2)
4:44.249 default L unstable_affliction Fluffy_Pillow 193858.2/1100000: 18% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2)
4:45.572 default C agony Fluffy_Pillow 210518.5/1100000: 19% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(3), accelerando
4:46.871 default E soul_harvest Fluffy_Pillow 194069.0/1100000: 18% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas(3), accelerando
4:46.871 default F potion Fluffy_Pillow 194069.0/1100000: 18% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror, active_uas(3), accelerando
4:46.871 default R drain_soul Fluffy_Pillow 194069.0/1100000: 18% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror, active_uas(3), accelerando, potion_of_prolonged_power
4:49.737 default R drain_soul Fluffy_Pillow 131584.5/1100000: 12% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, accelerando, potion_of_prolonged_power
4:51.698 default K corruption Fluffy_Pillow 90621.1/1100000: 8% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror(2), active_uas, accelerando(2), potion_of_prolonged_power
4:52.975 default L unstable_affliction Fluffy_Pillow 74171.8/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror(3), accelerando(2), potion_of_prolonged_power
4:54.252 default Q life_tap Fluffy_Pillow 90722.6/1100000: 8% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), active_uas, accelerando(2), potion_of_prolonged_power
4:55.530 default R drain_soul Fluffy_Pillow 437286.3/1100000: 40% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), compounding_horror(2), active_uas, accelerando(2), potion_of_prolonged_power

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 56169 56169 35271
Intellect 51031 49325 39649 (1278)
Spirit 0 0 0
Health 3370140 3370140 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 51031 49325 0
Crit 22.49% 22.49% 6995
Haste 13.83% 13.83% 5186
Damage / Heal Versatility 2.33% 2.33% 1107
ManaReg per Second 12521 12521 0
Mastery 116.66% 113.69% 11350
Armor 2001 2001 2001
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 910.00
Local Head Eyes of Azj'Aqir
ilevel: 905, stats: { 257 Armor, +3410 Sta, +2273 Int, +1094 Haste, +589 Vers }
Local Neck Beleron's Choker of Misery
ilevel: 905, stats: { +1918 Sta, +1727 Crit, +1295 Mastery }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Master Warmage's Leggings
ilevel: 905, stats: { 277 Armor, +3410 Sta, +2273 Int, +914 Mastery, +769 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Sin'dorei Spite
ilevel: 940, stats: { 157 Armor, +2658 Sta, +1772 Int, +694 Crit, +385 Haste }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Spellblade's Gemmed Signet
ilevel: 905, stats: { +1918 Sta, +2073 Crit, +950 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Temporal Recalibration
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +636 Mastery, +311 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Sindorei_Spite"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3518
neck=belerons_choker_of_misery,id=140899,bonus_id=3518,enchant=mark_of_the_trained_soldier
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518
back=cloak_of_temporal_recalibration,id=140910,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=sindorei_spite,id=132379,ilevel=940
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518
legs=master_warmages_leggings,id=140852,bonus_id=3518
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=spellblades_gemmed_signet,id=140895,bonus_id=3518,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=erratic_metronome,id=140792,bonus_id=3445
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=909.60
# gear_stamina=35271
# gear_intellect=39649
# gear_crit_rating=6858
# gear_haste_rating=5084
# gear_mastery_rating=11127
# gear_versatility_rating=1085
# gear_armor=2001
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Stretens_Sleepless_Shackles : 938478 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
938478.0 938478.0 1456.7 / 0.155% 206290.2 / 22.0% 30.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
28623.2 28623.2 Mana 0.00% 32.6 100.0% 100%
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Stretens_Sleepless_Shackles 938478
Agony 135150 14.4% 17.3 18.10sec 2346226 1929560 Periodic 192.0 144762 383536 211095 27.8% 99.7%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.27 0.00 191.97 191.97 1.2160 1.5585 40524609.94 40524609.94 0.00 126565.44 1929559.56
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 138.6 72.22% 144762.29 13263 253805 144790.20 122308 160111 20069984 20069984 0.00
crit 53.3 27.78% 383536.01 30769 670046 383504.45 274133 450302 20454626 20454626 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.039700
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 6411 0.7% 25.5 11.53sec 75334 0 Direct 25.5 62370 124855 75329 20.7%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.50 25.50 0.00 0.00 0.0000 0.0000 1921170.33 1921170.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.21 79.26% 62370.03 19880 199119 62575.05 37399 99303 1260677 1260677 0.00
crit 5.29 20.74% 124854.83 39759 398238 124915.21 0 398238 660494 660494 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 118217 12.6% 21.9 13.85sec 1615225 1357996 Periodic 191.5 126946 335903 185018 27.8% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 0.00 191.55 191.55 1.1894 1.5551 35439626.47 35439626.47 0.00 109391.35 1357996.19
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 138.3 72.21% 126946.37 469 217902 126997.56 111732 139940 17558401 17558401 0.00
crit 53.2 27.79% 335902.63 361 575261 335943.02 252819 401126 17881226 17881226 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.363000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 120503 12.8% 64.9 4.57sec 556254 196786 Periodic 221.0 127063 256573 163437 28.1% 57.0%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.94 0.00 221.01 221.01 2.8267 0.7742 36120651.49 36120651.49 0.00 196785.95 196785.95
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 158.9 71.91% 127062.71 79023 173696 127135.31 114351 136938 20195129 20195129 0.00
crit 62.1 28.09% 256573.37 158046 347391 256652.53 221907 280296 15925523 15925523 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 24883 2.7% 50.4 5.81sec 148001 0 Direct 50.1 123366 246197 148754 20.7%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.39 50.14 0.00 0.00 0.0000 0.0000 7458371.97 7458371.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.78 79.33% 123365.82 80762 168009 123368.09 107571 135799 4907063 4907063 0.00
crit 10.36 20.67% 246196.62 161524 323573 246113.05 0 296725 2551309 2551309 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rend Soul 19009 2.0% 16.1 17.39sec 354718 0 Direct 16.1 293221 587993 354701 20.9%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.07 16.07 0.00 0.00 0.0000 0.0000 5699609.60 5699609.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.72 79.14% 293221.21 186372 387708 293085.16 225807 373348 3728818 3728818 0.00
crit 3.35 20.86% 587993.48 372743 746696 564549.65 0 746696 1970792 1970792 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=12}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (435329) 0.0% (46.4%) 47.5 6.28sec 2743217 2338919

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.53 0.00 0.00 0.00 1.1729 0.0000 0.00 0.00 0.00 2338919.10 2338919.10
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 193002 20.6% 0.0 0.00sec 0 0 Periodic 109.4 319309 854494 528868 39.2% 50.7%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 109.40 109.40 0.0000 1.3913 57856682.94 57856682.94 0.00 380128.40 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.6 60.84% 319309.13 194 514402 319772.54 265320 379826 21252794 21252794 0.00
crit 42.8 39.16% 854494.33 1500 1358021 855275.99 594739 1027547 36603889 36603889 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 151295 16.1% 0.0 0.00sec 0 0 Periodic 80.4 339319 902981 563420 39.8% 36.9%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 80.43 80.43 0.0000 1.3746 45317037.65 45317037.65 0.00 409886.38 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.5 60.24% 339318.88 163 514402 340238.12 280917 421602 16441247 16441247 0.00
crit 32.0 39.76% 902980.80 839 1307724 905161.93 672269 1151590 28875791 28875791 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 84735 9.0% 0.0 0.00sec 0 0 Periodic 43.7 348103 928204 579218 39.8% 19.6%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 43.75 43.75 0.0000 1.3410 25338349.63 25338349.63 0.00 431915.96 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.3 60.16% 348103.12 117 514402 351912.03 235573 495350 9162178 9162178 0.00
crit 17.4 39.84% 928203.57 556 1358021 937217.76 306932 1307724 16176171 16176171 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 5387 0.6% 0.0 0.00sec 0 0 Periodic 3.1 320732 845635 525625 39.0% 1.4%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 3.05 3.05 0.0000 1.3898 1605159.25 1605159.25 0.00 378218.48 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.9 60.97% 320732.04 2345 495350 150382.82 0 495350 597130 597130 0.00
crit 1.2 39.03% 845634.83 5207 1307724 366440.22 0 1307724 1008029 1008029 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 911 0.1% 0.0 0.00sec 0 0 Periodic 0.5 307772 812016 502439 38.6% 0.3%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.53 0.53 0.0000 1.4153 268154.83 268154.83 0.00 355171.95 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 61.39% 307771.56 2680 495350 31251.34 0 495350 100846 100846 0.00
crit 0.2 38.61% 812015.69 9772 1307724 75456.32 0 1307724 167309 167309 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - doomguard 78976 / 78976
Doom Bolt 78976 8.4% 123.3 2.42sec 192074 81291 Direct 122.5 160026 320124 193313 20.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.29 122.50 0.00 0.00 2.3628 0.0000 23680322.26 23680322.26 0.00 81291.03 81291.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.03 79.21% 160025.50 132693 229607 160062.29 150977 167334 15527502 15527502 0.00
crit 25.47 20.79% 320124.26 265385 459214 320230.59 291862 354018 8152821 8152821 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Stretens_Sleepless_Shackles
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Stretens_Sleepless_Shackles
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Stretens_Sleepless_Shackles
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Stretens_Sleepless_Shackles
  • harmful:false
  • if_expr:
 
Life Tap 11.3 22.90sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.34 0.00 0.00 0.00 1.2089 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 12.5 24.73sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.46 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Soul Harvest 2.3 154.72sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.30 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.9 0.0 15.5sec 15.5sec 77.92% 77.92% 2.1(2.1) 19.1

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.04%
  • accelerando_2:23.65%
  • accelerando_3:14.45%
  • accelerando_4:6.91%
  • accelerando_5:3.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 22.6 24.9 13.4sec 0.0sec 55.97% 55.97% 0.0(0.0) 0.0

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:29.05%
  • active_uas_2:17.31%
  • active_uas_3:9.36%
  • active_uas_4:0.20%
  • active_uas_5:0.05%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 27.6 39.5 10.8sec 4.4sec 61.48% 100.00% 2.3(2.3) 1.6

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:25.70%
  • compounding_horror_2:16.85%
  • compounding_horror_3:9.88%
  • compounding_horror_4:5.12%
  • compounding_horror_5:3.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Deadwind Harvester 12.5 0.0 24.7sec 24.7sec 74.53% 74.53% 0.0(0.0) 11.5

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:74.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.3sec 68.3sec 8.75% 8.75% 0.0(0.0) 3.2

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.19

Stack Uptimes

  • devils_due_1:8.75%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Nefarious Pact 3.5 0.0 68.6sec 67.9sec 13.62% 13.62% 0.0(0.0) 3.3

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • nefarious_pact_1:13.62%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 164.6sec 0.0sec 38.54% 38.54% 0.0(0.0) 1.9

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:38.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.3 0.0 154.3sec 154.3sec 12.93% 12.93% 0.0(0.0) 2.3

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:12.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Streten's Insanity 19.5 0.0 15.6sec 0.0sec 65.03% 61.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_stretens_insanity
  • max_stacks:10
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • stretens_insanity_1:65.02%
  • stretens_insanity_2:0.04%

Spelldata details

  • id:208822
  • name:Streten's Insanity
  • tooltip:All Damage done increased by {$s1=4}%.
  • description:{$@spelldesc208821=Each enemy afflicted with your Unstable Affliction increases all damage you deal by {$208822s1=4}%.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Tormented Souls 13.2 34.8 23.6sec 6.6sec 76.24% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:22.86%
  • tormented_souls_2:18.32%
  • tormented_souls_3:13.61%
  • tormented_souls_4:9.54%
  • tormented_souls_5:5.71%
  • tormented_souls_6:3.28%
  • tormented_souls_7:1.77%
  • tormented_souls_8:0.64%
  • tormented_souls_9:0.28%
  • tormented_souls_10:0.13%
  • tormented_souls_11:0.06%
  • tormented_souls_12:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs

Procs

Count Interval
fatal_echos 5.9 41.4sec
t18_2pc_affliction 47.5 6.3sec
soul_conduit 9.5 28.1sec
souls_consumed 46.2 24.7sec

Resources

Resource Usage Type Count Total Average RPE APR
Stretens_Sleepless_Shackles
agony Mana 17.3 569977.2 33000.0 32999.6 71.1
corruption Mana 21.9 724054.2 33000.0 33000.1 48.9
drain_soul Mana 221.0 7293290.2 33000.0 112315.8 5.0
unstable_affliction Soul Shard 47.5 47.5 1.0 1.0 2743425.8
pet - doomguard
doom_bolt Energy 123.3 4315.1 35.0 35.0 5487.8
Resource Gains Type Count Total Average Overflow
life_tap Mana 11.34 3743517.89 (48.21%) 330000.00 0.00 0.00%
agony Soul Shard 35.31 35.31 (77.77%) 1.00 0.00 0.00%
drain_soul Soul Shard 0.59 0.59 (1.31%) 1.00 0.00 0.00%
mp5_regen Mana 350.16 4020989.94 (51.79%) 11483.42 21905.09 0.54%
soul_conduit Soul Shard 9.50 9.50 (20.92%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 198.02 4273.44 (100.00%) 21.58 119.67 2.72%
Resource RPS-Gain RPS-Loss
Health 0.00 12968.41
Mana 25880.43 28623.17
Soul Shard 0.15 0.16
Combat End Resource Mean Min Max
Mana 274136.45 24971.54 478584.53
Soul Shard 0.87 0.00 2.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.5%

Statistics & Data Analysis

Fight Length
Sample Data Stretens_Sleepless_Shackles Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Stretens_Sleepless_Shackles Damage Per Second
Count 4999
Mean 938478.02
Minimum 744139.38
Maximum 1136801.57
Spread ( max - min ) 392662.20
Range [ ( max - min ) / 2 * 100% ] 20.92%
Standard Deviation 52547.3034
5th Percentile 854539.83
95th Percentile 1026943.06
( 95th Percentile - 5th Percentile ) 172403.23
Mean Distribution
Standard Deviation 743.2054
95.00% Confidence Intervall ( 937021.36 - 939934.68 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 121
0.1% Error 12044
0.1 Scale Factor Error with Delta=300 23571355
0.05 Scale Factor Error with Delta=300 94285418
0.01 Scale Factor Error with Delta=300 2357135436
Priority Target DPS
Sample Data Stretens_Sleepless_Shackles Priority Target Damage Per Second
Count 4999
Mean 938478.02
Minimum 744139.38
Maximum 1136801.57
Spread ( max - min ) 392662.20
Range [ ( max - min ) / 2 * 100% ] 20.92%
Standard Deviation 52547.3034
5th Percentile 854539.83
95th Percentile 1026943.06
( 95th Percentile - 5th Percentile ) 172403.23
Mean Distribution
Standard Deviation 743.2054
95.00% Confidence Intervall ( 937021.36 - 939934.68 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 121
0.1% Error 12044
0.1 Scale Factor Error with Delta=300 23571355
0.05 Scale Factor Error with Delta=300 94285418
0.01 Scale Factor Error with Delta=300 2357135436
DPS(e)
Sample Data Stretens_Sleepless_Shackles Damage Per Second (Effective)
Count 4999
Mean 938478.02
Minimum 744139.38
Maximum 1136801.57
Spread ( max - min ) 392662.20
Range [ ( max - min ) / 2 * 100% ] 20.92%
Damage
Sample Data Stretens_Sleepless_Shackles Damage
Count 4999
Mean 257549424.09
Minimum 172896070.74
Maximum 349798357.60
Spread ( max - min ) 176902286.85
Range [ ( max - min ) / 2 * 100% ] 34.34%
DTPS
Sample Data Stretens_Sleepless_Shackles Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Stretens_Sleepless_Shackles Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Stretens_Sleepless_Shackles Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Stretens_Sleepless_Shackles Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Stretens_Sleepless_Shackles Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Stretens_Sleepless_Shackles Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Stretens_Sleepless_ShacklesTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Stretens_Sleepless_Shackles Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 1.49 reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
0.00 soul_effigy,if=!pet.soul_effigy.active
C 4.40 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 arcane_torrent
D 2.30 soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
0.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
E 0.97 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
F 0.78 corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
0.00 siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 phantom_singularity
0.00 haunt
0.00 agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
G 12.87 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
H 10.71 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
0.00 corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
I 14.67 corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
J 6.49 corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
0.00 siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
K 5.84 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
L 1.67 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
M 40.19 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
N 8.79 reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
O 2.18 reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
P 0.64 life_tap,if=mana.pct<=10
Q 49.14 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0156ACIMMMDNQLKQJQGLKMQJQLKKNQCQLQJQMOQCQILKMNQHQGILMMNQIQGMMMNQHJMQCQIMMMNQQHQGLJMQMDEQMQNQJQCMQHQIQGMMNQJQHQGQIMMNQQHQGIMMQIQGHMMNQJQGMQQHJMMNQGIMMQHQIGMMNQKDQJQQGHKKQBQJKQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Stretens_Sleepless_Shackles 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Stretens_Sleepless_Shackles 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 5 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Stretens_Sleepless_Shackles 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 default C agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.315 default I corruption Fluffy_Pillow 1088899.0/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, nefarious_pact, accelerando, potion_of_prolonged_power
0:02.069 default M unstable_affliction Fluffy_Pillow 1068455.5/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, nefarious_pact, accelerando, potion_of_prolonged_power
0:02.822 default M unstable_affliction Fluffy_Pillow 1080995.4/1100000: 98% mana | 3.0/5: 60% soul_shard bloodlust, stretens_insanity, active_uas, nefarious_pact, accelerando, potion_of_prolonged_power
0:03.576 default M unstable_affliction Fluffy_Pillow 1093551.9/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, stretens_insanity, active_uas(2), nefarious_pact, accelerando, potion_of_prolonged_power
0:04.331 default D soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, stretens_insanity, active_uas(3), nefarious_pact, accelerando, potion_of_prolonged_power
0:04.331 default N reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, stretens_insanity, active_uas(3), nefarious_pact, accelerando, potion_of_prolonged_power
0:04.331 default Q drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, stretens_insanity, deadwind_harvester, active_uas(3), nefarious_pact, accelerando, potion_of_prolonged_power
0:09.536 default L unstable_affliction Fluffy_Pillow 823679.9/1100000: 75% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror(2), nefarious_pact, accelerando, potion_of_prolonged_power
0:10.291 default K unstable_affliction Fluffy_Pillow 836253.1/1100000: 76% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, active_uas, nefarious_pact, accelerando, potion_of_prolonged_power
0:11.045 default Q drain_soul Fluffy_Pillow 848809.6/1100000: 77% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, active_uas, nefarious_pact, accelerando, potion_of_prolonged_power
0:12.168 default J corruption Fluffy_Pillow 801500.7/1100000: 73% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror, active_uas, devils_due, potion_of_prolonged_power
0:13.369 default Q drain_soul Fluffy_Pillow 788158.1/1100000: 72% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror, active_uas, devils_due, potion_of_prolonged_power
0:15.176 default G agony Fluffy_Pillow 751734.4/1100000: 68% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, devils_due, potion_of_prolonged_power
0:16.378 default L unstable_affliction Fluffy_Pillow 738408.2/1100000: 67% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, deadwind_harvester, tormented_souls, compounding_horror, devils_due, potion_of_prolonged_power
0:17.580 default K unstable_affliction Fluffy_Pillow 758269.4/1100000: 69% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, active_uas, devils_due, accelerando, potion_of_prolonged_power
0:18.761 default M unstable_affliction Fluffy_Pillow 777936.9/1100000: 71% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, active_uas(2), devils_due, accelerando, potion_of_prolonged_power
0:19.941 default Q drain_soul Fluffy_Pillow 797587.7/1100000: 73% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, active_uas(3), devils_due, accelerando, potion_of_prolonged_power
0:25.629 default J corruption Fluffy_Pillow 662340.7/1100000: 60% mana | 3.0/5: 60% soul_shard bloodlust, stretens_insanity, tormented_souls, compounding_horror, active_uas, accelerando(2), potion_of_prolonged_power
0:26.608 default Q drain_soul Fluffy_Pillow 645924.2/1100000: 59% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls, compounding_horror, accelerando(2), potion_of_prolonged_power
0:28.199 default L unstable_affliction Fluffy_Pillow 606874.5/1100000: 55% mana | 4.0/5: 80% soul_shard bloodlust, tormented_souls, compounding_horror, accelerando(2), potion_of_prolonged_power
0:29.177 default K unstable_affliction Fluffy_Pillow 623467.8/1100000: 57% mana | 4.0/5: 80% soul_shard bloodlust, stretens_insanity, tormented_souls, active_uas, potion_of_prolonged_power
0:30.188 default K unstable_affliction Fluffy_Pillow 640016.3/1100000: 58% mana | 4.0/5: 80% soul_shard bloodlust, stretens_insanity, tormented_souls, active_uas(2), accelerando, potion_of_prolonged_power
0:31.183 default N reap_souls Fluffy_Pillow 656586.2/1100000: 60% mana | 3.0/5: 60% soul_shard bloodlust, stretens_insanity, tormented_souls(2), active_uas(3), accelerando, potion_of_prolonged_power
0:31.183 default Q drain_soul Fluffy_Pillow 656586.2/1100000: 60% mana | 3.0/5: 60% soul_shard bloodlust, stretens_insanity, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
0:34.175 default C agony Fluffy_Pillow 574412.6/1100000: 52% mana | 3.0/5: 60% soul_shard bloodlust, stretens_insanity, deadwind_harvester, tormented_souls, active_uas(3), accelerando, potion_of_prolonged_power
0:35.171 default Q drain_soul Fluffy_Pillow 557999.2/1100000: 51% mana | 3.0/5: 60% soul_shard bloodlust, stretens_insanity, deadwind_harvester, tormented_souls, active_uas(2), accelerando, potion_of_prolonged_power
0:36.713 default L unstable_affliction Fluffy_Pillow 517810.9/1100000: 47% mana | 4.0/5: 80% soul_shard bloodlust, deadwind_harvester, tormented_souls(2), accelerando(2), potion_of_prolonged_power
0:37.692 default Q drain_soul Fluffy_Pillow 534394.3/1100000: 49% mana | 3.0/5: 60% soul_shard bloodlust, stretens_insanity, deadwind_harvester, tormented_souls(3), active_uas, accelerando(2), potion_of_prolonged_power
0:39.902 default J corruption Fluffy_Pillow 472830.0/1100000: 43% mana | 3.0/5: 60% soul_shard bloodlust, stretens_insanity, deadwind_harvester, tormented_souls(3), compounding_horror, active_uas, accelerando(2), potion_of_prolonged_power
0:40.881 default Q drain_soul Fluffy_Pillow 456413.5/1100000: 41% mana | 3.0/5: 60% soul_shard bloodlust, stretens_insanity, deadwind_harvester, tormented_souls(3), compounding_horror(2), active_uas, accelerando(2), potion_of_prolonged_power
0:42.357 default M unstable_affliction Fluffy_Pillow 409570.4/1100000: 37% mana | 3.0/5: 60% soul_shard stretens_insanity, tormented_souls(3), compounding_horror(2), active_uas, potion_of_prolonged_power
0:43.669 default O reap_souls Fluffy_Pillow 426089.0/1100000: 39% mana | 2.0/5: 40% soul_shard stretens_insanity, tormented_souls(3), active_uas, potion_of_prolonged_power
0:43.669 default Q drain_soul Fluffy_Pillow 426089.0/1100000: 39% mana | 2.0/5: 40% soul_shard stretens_insanity, deadwind_harvester, active_uas, potion_of_prolonged_power
0:51.699 default C agony Fluffy_Pillow 234185.3/1100000: 21% mana | 3.0/5: 60% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(5), potion_of_prolonged_power
0:52.909 default Q drain_soul Fluffy_Pillow 217749.3/1100000: 20% mana | 3.0/5: 60% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(5), potion_of_prolonged_power
0:54.888 default I corruption Fluffy_Pillow 178840.4/1100000: 16% mana | 4.0/5: 80% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(5), potion_of_prolonged_power
0:56.100 default L unstable_affliction Fluffy_Pillow 162431.8/1100000: 15% mana | 4.0/5: 80% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, accelerando(5), potion_of_prolonged_power
0:57.308 default K unstable_affliction Fluffy_Pillow 178045.4/1100000: 16% mana | 4.0/5: 80% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, active_uas, potion_of_prolonged_power
0:58.622 default M unstable_affliction Fluffy_Pillow 194589.3/1100000: 18% mana | 3.0/5: 60% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, active_uas(2)
0:59.935 default N reap_souls Fluffy_Pillow 211220.3/1100000: 19% mana | 2.0/5: 40% soul_shard stretens_insanity, tormented_souls, active_uas(3), accelerando
0:59.935 default Q drain_soul Fluffy_Pillow 211220.3/1100000: 19% mana | 2.0/5: 40% soul_shard stretens_insanity, deadwind_harvester, active_uas(3), accelerando
1:04.502 default H life_tap Fluffy_Pillow 105451.2/1100000: 10% mana | 3.0/5: 60% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, active_uas(2), accelerando(2)
1:05.774 default Q drain_soul Fluffy_Pillow 452025.5/1100000: 41% mana | 3.0/5: 60% soul_shard stretens_insanity, tormented_souls, active_uas, accelerando(2)
1:07.664 default G agony Fluffy_Pillow 410652.5/1100000: 37% mana | 3.0/5: 60% soul_shard tormented_souls, accelerando(2)
1:08.936 default I corruption Fluffy_Pillow 394226.9/1100000: 36% mana | 4.0/5: 80% soul_shard tormented_souls, compounding_horror, accelerando(2)
1:10.207 default L unstable_affliction Fluffy_Pillow 378067.5/1100000: 34% mana | 4.0/5: 80% soul_shard tormented_souls, compounding_horror, accelerando(3)
1:11.458 default M unstable_affliction Fluffy_Pillow 394643.1/1100000: 36% mana | 3.0/5: 60% soul_shard stretens_insanity, tormented_souls, active_uas, accelerando(3)
1:12.707 default M unstable_affliction Fluffy_Pillow 410383.7/1100000: 37% mana | 2.0/5: 40% soul_shard stretens_insanity, tormented_souls, active_uas(2)
1:14.020 default N reap_souls Fluffy_Pillow 426915.0/1100000: 39% mana | 1.0/5: 20% soul_shard stretens_insanity, tormented_souls(2), active_uas(3)
1:14.020 default Q drain_soul Fluffy_Pillow 426915.0/1100000: 39% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, active_uas(3)
1:22.078 default I corruption Fluffy_Pillow 232277.1/1100000: 21% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), accelerando
1:23.370 default Q drain_soul Fluffy_Pillow 215827.8/1100000: 20% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, accelerando
1:25.306 default G agony Fluffy_Pillow 174865.5/1100000: 16% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror, accelerando(2)
1:26.577 default M unstable_affliction Fluffy_Pillow 158426.8/1100000: 14% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror, accelerando(2)
1:27.847 default M unstable_affliction Fluffy_Pillow 175208.6/1100000: 16% mana | 3.0/5: 60% soul_shard stretens_insanity, tormented_souls(2), active_uas, accelerando(3)
1:29.096 default M unstable_affliction Fluffy_Pillow 191894.8/1100000: 17% mana | 2.0/5: 40% soul_shard stretens_insanity, tormented_souls(2), active_uas(2), accelerando(4)
1:30.326 default N reap_souls Fluffy_Pillow 208169.2/1100000: 19% mana | 2.0/5: 40% soul_shard stretens_insanity, tormented_souls(2), active_uas(3), accelerando
1:30.326 default Q drain_soul Fluffy_Pillow 208169.2/1100000: 19% mana | 2.0/5: 40% soul_shard stretens_insanity, deadwind_harvester, active_uas(3), accelerando
1:34.747 default H life_tap Fluffy_Pillow 100686.8/1100000: 9% mana | 2.0/5: 40% soul_shard stretens_insanity, deadwind_harvester, compounding_horror, active_uas(2), accelerando(3)
1:35.996 default J corruption Fluffy_Pillow 447235.8/1100000: 41% mana | 2.0/5: 40% soul_shard stretens_insanity, deadwind_harvester, compounding_horror, active_uas, accelerando(3)
1:37.248 default M unstable_affliction Fluffy_Pillow 430824.7/1100000: 39% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(3)
1:38.499 default Q drain_soul Fluffy_Pillow 447400.3/1100000: 41% mana | 2.0/5: 40% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, active_uas, accelerando(3)
1:45.457 default C agony Fluffy_Pillow 274337.5/1100000: 25% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror(2)
1:46.773 default Q drain_soul Fluffy_Pillow 257906.6/1100000: 23% mana | 2.0/5: 40% soul_shard tormented_souls, compounding_horror(2)
1:49.687 default I corruption Fluffy_Pillow 195682.4/1100000: 18% mana | 3.0/5: 60% soul_shard tormented_souls(2), compounding_horror(2), accelerando
1:50.980 default M unstable_affliction Fluffy_Pillow 179245.9/1100000: 16% mana | 3.0/5: 60% soul_shard tormented_souls(2), compounding_horror(2), accelerando
1:52.271 default M unstable_affliction Fluffy_Pillow 196055.3/1100000: 18% mana | 3.0/5: 60% soul_shard stretens_insanity, tormented_souls(3), active_uas, accelerando(2)
1:53.541 default M unstable_affliction Fluffy_Pillow 212603.6/1100000: 19% mana | 3.0/5: 60% soul_shard stretens_insanity, tormented_souls(4), active_uas(2), accelerando(2)
1:54.811 default N reap_souls Fluffy_Pillow 229151.9/1100000: 21% mana | 2.0/5: 40% soul_shard stretens_insanity, tormented_souls(4), active_uas(3), accelerando(2)
1:54.811 default Q drain_soul Fluffy_Pillow 229151.9/1100000: 21% mana | 2.0/5: 40% soul_shard stretens_insanity, deadwind_harvester, active_uas(3), accelerando(2)
1:58.394 default Q drain_soul Fluffy_Pillow 143839.0/1100000: 13% mana | 3.0/5: 60% soul_shard stretens_insanity, deadwind_harvester, active_uas(3), nefarious_pact, accelerando(2)
1:59.741 default H life_tap Fluffy_Pillow 95505.7/1100000: 9% mana | 3.0/5: 60% soul_shard stretens_insanity, deadwind_harvester, active_uas(2), nefarious_pact, accelerando(3)
2:00.596 default Q drain_soul Fluffy_Pillow 436834.4/1100000: 40% mana | 3.0/5: 60% soul_shard stretens_insanity, deadwind_harvester, active_uas, nefarious_pact, accelerando(3)
2:01.989 default G agony Fluffy_Pillow 388830.5/1100000: 35% mana | 4.0/5: 80% soul_shard stretens_insanity, deadwind_harvester, compounding_horror(2), nefarious_pact
2:02.887 default L unstable_affliction Fluffy_Pillow 367136.7/1100000: 33% mana | 4.0/5: 80% soul_shard stretens_insanity, deadwind_harvester, compounding_horror(2), nefarious_pact
2:03.783 default J corruption Fluffy_Pillow 378417.8/1100000: 34% mana | 3.0/5: 60% soul_shard stretens_insanity, deadwind_harvester, active_uas, nefarious_pact
2:04.682 default M unstable_affliction Fluffy_Pillow 356736.6/1100000: 32% mana | 3.0/5: 60% soul_shard stretens_insanity, deadwind_harvester, compounding_horror, active_uas, nefarious_pact
2:05.582 default Q drain_soul Fluffy_Pillow 368068.0/1100000: 33% mana | 2.0/5: 40% soul_shard stretens_insanity, deadwind_harvester, active_uas(2), nefarious_pact
2:07.068 default M unstable_affliction Fluffy_Pillow 320990.5/1100000: 29% mana | 2.0/5: 40% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, active_uas(2), nefarious_pact, accelerando
2:07.952 default D soul_harvest Fluffy_Pillow 332314.7/1100000: 30% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, active_uas(3), devils_due, accelerando
2:07.952 default E potion Fluffy_Pillow 332314.7/1100000: 30% mana | 1.0/5: 20% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, active_uas(3), devils_due, accelerando
2:07.952 default Q drain_soul Fluffy_Pillow 332314.7/1100000: 30% mana | 1.0/5: 20% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, active_uas(3), devils_due, accelerando, potion_of_prolonged_power
2:10.309 default M unstable_affliction Fluffy_Pillow 296508.3/1100000: 27% mana | 1.0/5: 20% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, active_uas(2), devils_due, accelerando, potion_of_prolonged_power
2:11.841 default Q drain_soul Fluffy_Pillow 316133.4/1100000: 29% mana | 0.0/5: 0% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, active_uas(2), devils_due, accelerando, potion_of_prolonged_power
2:15.047 default N reap_souls Fluffy_Pillow 258684.0/1100000: 24% mana | 1.0/5: 20% soul_shard soul_harvest, stretens_insanity, tormented_souls, active_uas(2), devils_due, accelerando(2), potion_of_prolonged_power
2:15.047 default Q drain_soul Fluffy_Pillow 258684.0/1100000: 24% mana | 1.0/5: 20% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, active_uas(2), devils_due, accelerando(2), potion_of_prolonged_power
2:18.296 default J corruption Fluffy_Pillow 202758.0/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror(2), active_uas, potion_of_prolonged_power
2:19.610 default Q drain_soul Fluffy_Pillow 186301.8/1100000: 17% mana | 1.0/5: 20% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror(4), active_uas, potion_of_prolonged_power
2:21.676 default C agony Fluffy_Pillow 146313.7/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, compounding_horror(4), potion_of_prolonged_power
2:22.990 default M unstable_affliction Fluffy_Pillow 129857.6/1100000: 12% mana | 1.0/5: 20% soul_shard soul_harvest, tormented_souls, compounding_horror(4), potion_of_prolonged_power
2:24.306 default Q drain_soul Fluffy_Pillow 146426.6/1100000: 13% mana | 0.0/5: 0% soul_shard soul_harvest, stretens_insanity, tormented_souls, active_uas, potion_of_prolonged_power
2:26.409 default H life_tap Fluffy_Pillow 106951.6/1100000: 10% mana | 1.0/5: 20% soul_shard stretens_insanity, tormented_souls, active_uas, accelerando, potion_of_prolonged_power
2:27.702 default Q drain_soul Fluffy_Pillow 453515.1/1100000: 41% mana | 1.0/5: 20% soul_shard stretens_insanity, tormented_souls, active_uas, accelerando, potion_of_prolonged_power
2:31.411 default I corruption Fluffy_Pillow 369028.0/1100000: 34% mana | 1.0/5: 20% soul_shard tormented_souls, accelerando, potion_of_prolonged_power
2:32.703 default Q drain_soul Fluffy_Pillow 352578.7/1100000: 32% mana | 1.0/5: 20% soul_shard tormented_souls(2), accelerando, potion_of_prolonged_power
2:37.265 default G agony Fluffy_Pillow 246728.3/1100000: 22% mana | 2.0/5: 40% soul_shard tormented_souls(3), compounding_horror, accelerando(3), potion_of_prolonged_power
2:38.515 default M unstable_affliction Fluffy_Pillow 230079.0/1100000: 21% mana | 2.0/5: 40% soul_shard tormented_souls(3), compounding_horror, potion_of_prolonged_power
2:39.830 default M unstable_affliction Fluffy_Pillow 246735.2/1100000: 22% mana | 1.0/5: 20% soul_shard stretens_insanity, tormented_souls(3), active_uas, accelerando, potion_of_prolonged_power
2:41.122 default N reap_souls Fluffy_Pillow 263285.9/1100000: 24% mana | 0.0/5: 0% soul_shard stretens_insanity, tormented_souls(3), active_uas(2), accelerando, potion_of_prolonged_power
2:41.122 default Q drain_soul Fluffy_Pillow 263285.9/1100000: 24% mana | 0.0/5: 0% soul_shard stretens_insanity, deadwind_harvester, active_uas(2), accelerando, potion_of_prolonged_power
2:45.634 default J corruption Fluffy_Pillow 156085.3/1100000: 14% mana | 0.0/5: 0% soul_shard stretens_insanity, deadwind_harvester, compounding_horror, active_uas(2), accelerando, potion_of_prolonged_power
2:46.926 default Q drain_soul Fluffy_Pillow 139636.0/1100000: 13% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, compounding_horror, active_uas, accelerando, potion_of_prolonged_power
2:48.932 default H life_tap Fluffy_Pillow 99333.2/1100000: 9% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror, accelerando, potion_of_prolonged_power
2:50.224 default Q drain_soul Fluffy_Pillow 446004.1/1100000: 41% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror(2), accelerando(2), potion_of_prolonged_power
2:56.454 default G agony Fluffy_Pillow 294016.8/1100000: 27% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror(3), potion_of_prolonged_power
2:57.768 default Q drain_soul Fluffy_Pillow 277560.7/1100000: 25% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror(5), potion_of_prolonged_power
2:59.681 default I corruption Fluffy_Pillow 235682.9/1100000: 21% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror(5), accelerando, potion_of_prolonged_power
3:00.973 default M unstable_affliction Fluffy_Pillow 219322.3/1100000: 20% mana | 2.0/5: 40% soul_shard tormented_souls(2), compounding_horror(5), accelerando(2), potion_of_prolonged_power
3:02.244 default M unstable_affliction Fluffy_Pillow 235883.6/1100000: 21% mana | 1.0/5: 20% soul_shard stretens_insanity, tormented_souls(3), active_uas, accelerando(2), potion_of_prolonged_power
3:03.513 default N reap_souls Fluffy_Pillow 252439.5/1100000: 23% mana | 0.0/5: 0% soul_shard stretens_insanity, tormented_souls(3), active_uas(2), accelerando(3), potion_of_prolonged_power
3:03.513 default Q drain_soul Fluffy_Pillow 252439.5/1100000: 23% mana | 0.0/5: 0% soul_shard stretens_insanity, deadwind_harvester, active_uas(2), accelerando(3), potion_of_prolonged_power
3:07.869 default Q drain_soul Fluffy_Pillow 145156.0/1100000: 13% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror, active_uas(2), accelerando(3), potion_of_prolonged_power
3:09.752 default H life_tap Fluffy_Pillow 104105.5/1100000: 9% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror, active_uas, accelerando(3)
3:11.002 default Q drain_soul Fluffy_Pillow 450667.8/1100000: 41% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls(2), compounding_horror, accelerando(3)
3:12.853 default G agony Fluffy_Pillow 408310.3/1100000: 37% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls(2), compounding_horror
3:14.168 default I corruption Fluffy_Pillow 392014.9/1100000: 36% mana | 2.0/5: 40% soul_shard stretens_insanity, deadwind_harvester, tormented_souls(2), compounding_horror(2), accelerando
3:15.462 default M unstable_affliction Fluffy_Pillow 375591.2/1100000: 34% mana | 2.0/5: 40% soul_shard stretens_insanity, deadwind_harvester, tormented_souls(2), compounding_horror(2), accelerando
3:16.755 default M unstable_affliction Fluffy_Pillow 392154.8/1100000: 36% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls(2), active_uas, accelerando
3:18.047 default Q drain_soul Fluffy_Pillow 408705.5/1100000: 37% mana | 0.0/5: 0% soul_shard stretens_insanity, deadwind_harvester, tormented_souls(2), active_uas, accelerando
3:27.726 default I corruption Fluffy_Pillow 169684.3/1100000: 15% mana | 1.0/5: 20% soul_shard tormented_souls(2), accelerando
3:29.019 default Q drain_soul Fluffy_Pillow 153247.8/1100000: 14% mana | 1.0/5: 20% soul_shard tormented_souls(2), accelerando
3:30.859 default G agony Fluffy_Pillow 110854.8/1100000: 10% mana | 2.0/5: 40% soul_shard tormented_souls(3), accelerando(2)
3:32.131 default H life_tap Fluffy_Pillow 94429.1/1100000: 9% mana | 2.0/5: 40% soul_shard tormented_souls(3), accelerando(2)
3:33.401 default M unstable_affliction Fluffy_Pillow 441195.0/1100000: 40% mana | 2.0/5: 40% soul_shard tormented_souls(3), accelerando(3)
3:34.650 default M unstable_affliction Fluffy_Pillow 457865.1/1100000: 42% mana | 1.0/5: 20% soul_shard stretens_insanity, tormented_souls(3), active_uas, accelerando(4)
3:35.879 default N reap_souls Fluffy_Pillow 474419.2/1100000: 43% mana | 0.0/5: 0% soul_shard stretens_insanity, tormented_souls(3), active_uas(2), accelerando(4)
3:35.879 default Q drain_soul Fluffy_Pillow 474419.2/1100000: 43% mana | 0.0/5: 0% soul_shard stretens_insanity, deadwind_harvester, active_uas(2), accelerando(4)
3:41.858 default J corruption Fluffy_Pillow 320666.8/1100000: 29% mana | 0.0/5: 0% soul_shard stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror(3), active_uas, accelerando
3:43.149 default Q drain_soul Fluffy_Pillow 304204.7/1100000: 28% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando
3:49.363 default G agony Fluffy_Pillow 152807.1/1100000: 14% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando
3:50.655 default M unstable_affliction Fluffy_Pillow 136357.8/1100000: 12% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando
3:51.949 default Q drain_soul Fluffy_Pillow 152924.7/1100000: 14% mana | 0.0/5: 0% soul_shard stretens_insanity, tormented_souls, active_uas, accelerando(2)
3:53.825 default Q drain_soul Fluffy_Pillow 111369.3/1100000: 10% mana | 1.0/5: 20% soul_shard stretens_insanity, tormented_souls(3), active_uas, accelerando(2)
3:55.805 default H life_tap Fluffy_Pillow 71169.0/1100000: 6% mana | 1.0/5: 20% soul_shard stretens_insanity, tormented_souls(4), compounding_horror, active_uas, accelerando(2)
3:57.076 default J corruption Fluffy_Pillow 417730.3/1100000: 38% mana | 1.0/5: 20% soul_shard stretens_insanity, tormented_souls(4), compounding_horror, active_uas, accelerando(2)
3:58.346 default M unstable_affliction Fluffy_Pillow 401278.6/1100000: 36% mana | 1.0/5: 20% soul_shard stretens_insanity, tormented_souls(4), compounding_horror, active_uas, accelerando(2)
3:59.617 default M unstable_affliction Fluffy_Pillow 417840.0/1100000: 38% mana | 1.0/5: 20% soul_shard stretens_insanity, tormented_souls(5), active_uas, accelerando(2)
4:00.888 default N reap_souls Fluffy_Pillow 434401.3/1100000: 39% mana | 0.0/5: 0% soul_shard stretens_insanity, tormented_souls(5), active_uas(2), accelerando(2)
4:00.888 default Q drain_soul Fluffy_Pillow 434401.3/1100000: 39% mana | 0.0/5: 0% soul_shard stretens_insanity, deadwind_harvester, active_uas(2), accelerando(2)
4:07.914 default G agony Fluffy_Pillow 260858.2/1100000: 24% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls(2), compounding_horror(3), accelerando
4:09.207 default I corruption Fluffy_Pillow 244421.7/1100000: 22% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls(2), compounding_horror(3), accelerando
4:10.500 default M unstable_affliction Fluffy_Pillow 227985.3/1100000: 21% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls(2), compounding_horror(4), accelerando
4:11.794 default M unstable_affliction Fluffy_Pillow 244561.6/1100000: 22% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls(2), active_uas, accelerando
4:13.086 default Q drain_soul Fluffy_Pillow 261178.4/1100000: 24% mana | 0.0/5: 0% soul_shard stretens_insanity, deadwind_harvester, tormented_souls(2), active_uas(2), accelerando(2)
4:19.129 default H life_tap Fluffy_Pillow 108924.5/1100000: 10% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, tormented_souls(3), compounding_horror(4), accelerando
4:20.421 default Q drain_soul Fluffy_Pillow 455475.2/1100000: 41% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(4), accelerando
4:24.128 default I corruption Fluffy_Pillow 370962.5/1100000: 34% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(5), accelerando
4:25.419 default G agony Fluffy_Pillow 354500.4/1100000: 32% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(4), compounding_horror(5), accelerando
4:26.711 default M unstable_affliction Fluffy_Pillow 338335.4/1100000: 31% mana | 2.0/5: 40% soul_shard tormented_souls(4), compounding_horror(5), accelerando(2)
4:27.981 default M unstable_affliction Fluffy_Pillow 354883.7/1100000: 32% mana | 1.0/5: 20% soul_shard stretens_insanity, tormented_souls(4), active_uas, accelerando(2)
4:29.249 default N reap_souls Fluffy_Pillow 371045.8/1100000: 34% mana | 0.0/5: 0% soul_shard stretens_insanity, tormented_souls(4), active_uas(2)
4:29.249 default Q drain_soul Fluffy_Pillow 371045.8/1100000: 34% mana | 0.0/5: 0% soul_shard stretens_insanity, deadwind_harvester, active_uas(2)
4:32.908 default K unstable_affliction Fluffy_Pillow 285308.5/1100000: 26% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, compounding_horror, active_uas(2), accelerando
4:34.200 default D soul_harvest Fluffy_Pillow 301953.6/1100000: 27% mana | 0.0/5: 0% soul_shard stretens_insanity, deadwind_harvester, active_uas(3), accelerando(2)
4:34.200 default Q drain_soul Fluffy_Pillow 301953.6/1100000: 27% mana | 0.0/5: 0% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, active_uas(3), accelerando(2)
4:37.802 default J corruption Fluffy_Pillow 217173.8/1100000: 20% mana | 0.0/5: 0% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror, active_uas, accelerando(4)
4:39.032 default Q drain_soul Fluffy_Pillow 200741.4/1100000: 18% mana | 0.0/5: 0% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls, compounding_horror, active_uas, accelerando(4)
4:41.802 default Q drain_soul Fluffy_Pillow 139052.1/1100000: 13% mana | 0.0/5: 0% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror, accelerando(4)
4:43.710 default G agony Fluffy_Pillow 99171.3/1100000: 9% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror, accelerando(5)
4:44.919 default H life_tap Fluffy_Pillow 81738.2/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), compounding_horror
4:46.233 default K unstable_affliction Fluffy_Pillow 428282.0/1100000: 39% mana | 1.0/5: 20% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2)
4:47.548 default K unstable_affliction Fluffy_Pillow 444838.5/1100000: 40% mana | 1.0/5: 20% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls(2), active_uas
4:48.864 default Q drain_soul Fluffy_Pillow 461407.5/1100000: 42% mana | 0.0/5: 0% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, tormented_souls(2), active_uas(2)
4:50.877 default B reap_souls Fluffy_Pillow 420828.8/1100000: 38% mana | 0.0/5: 0% soul_shard soul_harvest, stretens_insanity, tormented_souls(3), active_uas(2), accelerando
4:50.877 default Q drain_soul Fluffy_Pillow 420828.8/1100000: 38% mana | 0.0/5: 0% soul_shard soul_harvest, stretens_insanity, deadwind_harvester, active_uas(2), accelerando
4:52.831 default J corruption Fluffy_Pillow 379859.8/1100000: 35% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, compounding_horror, active_uas(2), accelerando
4:54.122 default K unstable_affliction Fluffy_Pillow 363432.9/1100000: 33% mana | 1.0/5: 20% soul_shard stretens_insanity, deadwind_harvester, compounding_horror, active_uas(2), accelerando(2)
4:55.392 default Q drain_soul Fluffy_Pillow 379982.1/1100000: 35% mana | 0.0/5: 0% soul_shard stretens_insanity, deadwind_harvester, active_uas(2), accelerando(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 56169 56169 35271
Intellect 51031 49325 39649 (1278)
Spirit 0 0 0
Health 3370140 3370140 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 51031 49325 0
Crit 20.72% 20.72% 6287
Haste 14.46% 14.46% 5422
Damage / Heal Versatility 2.33% 2.33% 1107
ManaReg per Second 12590 12590 0
Mastery 120.34% 117.34% 11821
Armor 2001 2001 2001
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 910.00
Local Head Eyes of Azj'Aqir
ilevel: 905, stats: { 257 Armor, +3410 Sta, +2273 Int, +1094 Haste, +589 Vers }
Local Neck Beleron's Choker of Misery
ilevel: 905, stats: { +1918 Sta, +1727 Crit, +1295 Mastery }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Master Warmage's Leggings
ilevel: 905, stats: { 277 Armor, +3410 Sta, +2273 Int, +914 Mastery, +769 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Streten's Sleepless Shackles
ilevel: 940, stats: { 157 Armor, +2658 Sta, +1772 Int, +617 Haste, +462 Mastery }
Local Hands Clutch of Azj'Aqir
ilevel: 905, stats: { 198 Armor, +2558 Sta, +1705 Int, +875 Crit, +387 Mastery }
Local Finger1 Spellblade's Gemmed Signet
ilevel: 905, stats: { +1918 Sta, +2073 Crit, +950 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 910, stats: { +2010 Sta, +2227 Mastery, +890 Haste }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Temporal Recalibration
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +636 Mastery, +311 Haste }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +59 ilevels, +61 ilevels, +59 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Siphon Life Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Soul Effigy Phantom Singularity Soul Conduit

Profile

warlock="Stretens_Sleepless_Shackles"
level=110
race=human
role=spell
position=back
talents=3103013
artifact=39:0:0:0:0:915:3:916:3:917:3:918:3:919:3:920:3:921:3:922:3:923:3:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1711:1
spec=affliction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=reap_souls,if=!buff.deadwind_harvester.remains&(buff.soul_harvest.remains>5+equipped.144364*1.5&!talent.malefic_grasp.enabled&buff.active_uas.stack>1|buff.tormented_souls.react>=8|target.time_to_die<=buff.tormented_souls.react*5+equipped.144364*1.5|!talent.malefic_grasp.enabled&(trinket.proc.any.react|trinket.stacking_proc.any.react))
actions+=/soul_effigy,if=!pet.soul_effigy.active
actions+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/soul_harvest,if=buff.active_uas.stack>=3|!equipped.132394&!equipped.132457&(debuff.haunt.remains|talent.writhe_in_agony.enabled)
actions+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2|buff.nefarious_pact.react)
actions+=/corruption,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<4)
actions+=/siphon_life,if=remains<=tick_time+gcd&(buff.active_uas.stack<2&soul_shard=0|!talent.malefic_grasp.enabled)
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&active_enemies>1&remains<=tick_time+gcd
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/phantom_singularity
actions+=/haunt
actions+=/agony,cycle_targets=1,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=4|spell_targets.seed_of_corruption=3&dot.corruption.remains<=cast_time+travel_time
actions+=/corruption,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/corruption,cycle_targets=1,if=(talent.absolute_corruption.enabled|!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=!talent.malefic_grasp.enabled&remains<=duration*0.3&target.time_to_die>=remains
actions+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions+=/siphon_life,cycle_targets=1,if=(!talent.malefic_grasp.enabled|!talent.soul_effigy.enabled)&remains<=duration*0.3&target.time_to_die>=remains
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&talent.haunt.enabled&(soul_shard>=4|debuff.haunt.remains>6.5|target.time_to_die<30)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.writhe_in_agony.enabled&(soul_shard>=4|trinket.proc.intellect.react|trinket.stacking_proc.mastery.react|trinket.proc.mastery.react|trinket.proc.crit.react|trinket.proc.versatility.react|buff.soul_harvest.remains|buff.deadwind_harvester.remains|buff.compounding_horror.react=5|target.time_to_die<=20)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(soul_shard=5|talent.contagion.enabled&soul_shard>=4)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&(talent.soul_effigy.enabled|equipped.132457)&!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&equipped.132457&buff.active_uas.stack=0
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&talent.soul_effigy.enabled&!equipped.132457&buff.active_uas.stack=0&dot.agony.remains>cast_time*3+6.5&(!talent.soul_effigy.enabled|pet.soul_effigy.dot.agony.remains>cast_time*3+6.5)
actions+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<4&talent.malefic_grasp.enabled&!talent.soul_effigy.enabled&!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*3+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)
actions+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&((!trinket.has_stacking_stat.any&!trinket.has_stat.any)|talent.malefic_grasp.enabled)&buff.tormented_souls.react>1
actions+=/life_tap,if=mana.pct<=10
actions+=/drain_soul,chain=1,interrupt=1
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3518
neck=belerons_choker_of_misery,id=140899,bonus_id=3518,enchant=mark_of_the_trained_soldier
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518
back=cloak_of_temporal_recalibration,id=140910,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=stretens_sleepless_shackles,id=132381,ilevel=940
hands=clutch_of_azjaqir,id=138311,bonus_id=3518
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518
legs=master_warmages_leggings,id=140852,bonus_id=3518
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=spellblades_gemmed_signet,id=140895,bonus_id=3518,enchant_id=5429
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3519,enchant_id=5429
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519
trinket2=erratic_metronome,id=140792,bonus_id=3445
main_hand=ulthalesh_the_deadwind_harvester,id=128942,gem_id=140822/140820/140822,relic_id=3518/3519/3518

# Gear Summary
# gear_ilvl=909.60
# gear_stamina=35271
# gear_intellect=39649
# gear_crit_rating=6164
# gear_haste_rating=5316
# gear_mastery_rating=11589
# gear_versatility_rating=1085
# gear_armor=2001
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=felhunter

Simulation & Raid Information

Iterations: 5003
Threads: 4
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 142265267
Max Event Queue: 390
Sim Seconds: 1500952
CPU Seconds: 389.9687
Physical Seconds: 98.2430
Speed Up: 3849

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Baseline Baseline agony ticks -980 38795515 129318 37.84 139561 369438 17.3 189.2 28.5% 0.0% 0.0% 0.0% 18.09sec 38795515 300.01sec
Baseline Baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Baseline Baseline compounding_horror 231489 1860523 6202 5.02 60804 121951 25.1 25.1 21.8% 0.0% 0.0% 0.0% 11.78sec 1860523 300.01sec
Baseline Baseline corruption ticks -172 33937244 113124 37.76 122318 322954 21.9 188.8 28.6% 0.0% 0.0% 0.0% 13.85sec 33937244 300.01sec
Baseline Baseline drain_soul ticks -198590 34257918 114193 43.47 121763 245964 64.1 217.4 28.9% 0.0% 0.0% 0.0% 4.63sec 34257918 300.01sec
Baseline Baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Baseline Baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Baseline Baseline harvester_of_souls 218615 7099649 23665 9.86 118477 236824 49.5 49.3 21.6% 0.0% 0.0% 0.0% 5.93sec 7099649 300.01sec
Baseline Baseline life_tap 1454 0 0 0.00 0 0 11.1 0.0 0.0% 0.0% 0.0% 0.0% 23.20sec 0 300.01sec
Baseline Baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Baseline Baseline reap_souls 216698 0 0 0.00 0 0 12.5 0.0 0.0% 0.0% 0.0% 0.0% 24.63sec 0 300.01sec
Baseline Baseline rend_soul 242834 5397588 17991 3.15 281547 561245 15.8 15.8 21.8% 0.0% 0.0% 0.0% 17.77sec 5397588 300.01sec
Baseline Baseline soul_harvest 196098 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 154.55sec 0 300.01sec
Baseline Baseline summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Baseline Baseline unstable_affliction 30108 0 0 0.00 0 0 46.9 0.0 0.0% 0.0% 0.0% 0.0% 6.37sec 0 300.01sec
Baseline Baseline unstable_affliction_1 ticks -233490 55058917 183530 21.63 305108 814877 0.0 108.1 40.0% 0.0% 0.0% 0.0% 0.00sec 55058917 300.01sec
Baseline Baseline unstable_affliction_2 ticks -233496 43020472 143402 15.85 323449 862882 0.0 79.2 40.7% 0.0% 0.0% 0.0% 0.00sec 43020472 300.01sec
Baseline Baseline unstable_affliction_3 ticks -233497 23910097 79700 8.58 332806 884561 0.0 42.9 40.7% 0.0% 0.0% 0.0% 0.00sec 23910097 300.01sec
Baseline Baseline unstable_affliction_4 ticks -233498 1543636 5145 0.60 306218 819005 0.0 3.0 40.5% 0.0% 0.0% 0.0% 0.00sec 1543636 300.01sec
Baseline Baseline unstable_affliction_5 ticks -233499 251729 839 0.10 292004 776301 0.0 0.5 40.5% 0.0% 0.0% 0.0% 0.00sec 251729 300.01sec
Baseline Baseline_doomguard doom_bolt 85692 23253504 77509 24.16 158261 316468 121.6 120.8 21.6% 0.0% 0.0% 0.0% 2.46sec 23253504 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy agony ticks -980 40098788 133663 38.59 138720 367324 17.3 192.9 30.2% 0.0% 0.0% 0.0% 18.10sec 40098788 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy compounding_horror 231489 1942801 6476 5.13 61434 122865 25.7 25.7 23.2% 0.0% 0.0% 0.0% 11.56sec 1942801 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy corruption ticks -172 35007632 116692 38.49 121678 321117 21.9 192.5 30.2% 0.0% 0.0% 0.0% 13.85sec 35007632 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy drain_soul ticks -198590 35598870 118663 44.44 122261 246799 65.2 222.2 30.5% 0.0% 0.0% 0.0% 4.56sec 35598870 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy harvester_of_souls 218615 7375398 24584 10.07 118959 237907 50.6 50.3 23.2% 0.0% 0.0% 0.0% 5.81sec 7375398 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy life_tap 1454 0 0 0.00 0 0 11.4 0.0 0.0% 0.0% 0.0% 0.0% 22.77sec 0 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy reap_souls 216698 0 0 0.00 0 0 12.4 0.0 0.0% 0.0% 0.0% 0.0% 24.90sec 0 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy rend_soul 242834 5652947 18843 3.25 282069 564654 16.2 16.2 23.4% 0.0% 0.0% 0.0% 17.27sec 5652947 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy soul_harvest 196098 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 154.22sec 0 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy unstable_affliction 30108 0 0 0.00 0 0 47.7 0.0 0.0% 0.0% 0.0% 0.0% 6.27sec 0 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy unstable_affliction_1 ticks -233490 56453750 188179 21.98 303319 808308 0.0 109.9 41.7% 0.0% 0.0% 0.0% 0.00sec 56453750 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy unstable_affliction_2 ticks -233496 44080276 146934 16.13 322132 854552 0.0 80.6 42.2% 0.0% 0.0% 0.0% 0.00sec 44080276 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy unstable_affliction_3 ticks -233497 24706480 82355 8.79 330418 879395 0.0 44.0 42.2% 0.0% 0.0% 0.0% 0.00sec 24706480 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy unstable_affliction_4 ticks -233498 1611577 5372 0.62 303926 809742 0.0 3.1 42.5% 0.0% 0.0% 0.0% 0.00sec 1611577 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy unstable_affliction_5 ticks -233499 271019 903 0.11 291975 759592 0.0 0.6 41.3% 0.0% 0.0% 0.0% 0.00sec 271019 300.01sec
Celumbra_the_Nights_Dichotomy Celumbra_the_Nights_Dichotomy_doomguard doom_bolt 85692 24085225 80281 24.61 158939 317722 123.8 123.1 23.2% 0.0% 0.0% 0.0% 2.41sec 24085225 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain agony ticks -980 44101599 147005 40.51 144878 382899 18.9 202.5 30.6% 0.0% 0.0% 0.0% 16.49sec 44101599 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain compounding_horror 231489 1953307 6511 5.21 60502 121826 26.0 26.0 23.7% 0.0% 0.0% 0.0% 11.36sec 1953307 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain corruption ticks -172 34991349 116638 36.75 126773 334936 21.9 183.8 30.6% 0.0% 0.0% 0.0% 13.85sec 34991349 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain drain_soul ticks -198590 33073531 110245 40.73 123376 249048 60.0 203.7 31.1% 0.0% 0.0% 0.0% 4.95sec 33073531 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain harvester_of_souls 218615 7055749 23518 9.53 119728 239221 47.9 47.7 23.7% 0.0% 0.0% 0.0% 6.11sec 7055749 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain life_tap 1454 0 0 0.00 0 0 10.2 0.0 0.0% 0.0% 0.0% 0.0% 25.08sec 0 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain reap_souls 216698 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.40sec 0 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain rend_soul 242834 5234069 17446 2.97 284364 567824 14.9 14.9 23.9% 0.0% 0.0% 0.0% 18.56sec 5234069 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain soul_harvest 196098 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 149.99sec 0 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain unstable_affliction 30108 0 0 0.00 0 0 49.9 0.0 0.0% 0.0% 0.0% 0.0% 5.98sec 0 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain unstable_affliction_1 ticks -233490 57325239 191084 21.62 311967 833854 0.0 108.1 41.9% 0.0% 0.0% 0.0% 0.00sec 57325239 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain unstable_affliction_2 ticks -233496 48132133 160440 16.83 334457 892959 0.0 84.1 42.5% 0.0% 0.0% 0.0% 0.00sec 48132133 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain unstable_affliction_3 ticks -233497 29812646 99375 10.22 342266 910430 0.0 51.1 42.5% 0.0% 0.0% 0.0% 0.00sec 29812646 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain unstable_affliction_4 ticks -233498 2536618 8455 0.96 310638 829250 0.0 4.8 41.8% 0.0% 0.0% 0.0% 0.00sec 2536618 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain unstable_affliction_5 ticks -233499 506959 1690 0.20 298241 792058 0.0 1.0 41.8% 0.0% 0.0% 0.0% 0.00sec 506959 300.01sec
Hood_of_Eternal_Disdain Hood_of_Eternal_Disdain_doomguard doom_bolt 85692 23205809 77350 23.54 159244 318596 118.5 117.7 23.8% 0.0% 0.0% 0.0% 2.52sec 23205809 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish agony ticks -980 39776840 132589 37.14 144071 380497 17.3 185.7 29.7% 0.0% 0.0% 0.0% 18.13sec 39776840 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish compounding_horror 231489 1865963 6220 4.96 61251 122549 24.8 24.8 22.9% 0.0% 0.0% 0.0% 11.96sec 1865963 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish corruption ticks -172 34775995 115920 37.03 126092 333335 21.9 185.1 29.8% 0.0% 0.0% 0.0% 13.85sec 34775995 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish drain_soul ticks -198590 34245823 114153 42.35 123872 250173 64.0 211.7 30.0% 0.0% 0.0% 0.0% 4.64sec 34245823 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish harvester_of_souls 218615 7129674 23765 9.63 120666 241296 48.4 48.2 22.7% 0.0% 0.0% 0.0% 6.08sec 7129674 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish kiljaedens_burning_wish 235999 3718761 12395 0.89 0 838600 4.5 4.4 100.0% 0.0% 0.0% 0.0% 75.60sec 3718761 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish life_tap 1454 0 0 0.00 0 0 10.8 0.0 0.0% 0.0% 0.0% 0.0% 23.87sec 0 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish reap_souls 216698 0 0 0.00 0 0 12.4 0.0 0.0% 0.0% 0.0% 0.0% 24.82sec 0 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish rend_soul 242834 5406322 18020 3.08 286306 571760 15.4 15.4 22.7% 0.0% 0.0% 0.0% 17.96sec 5406322 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish soul_harvest 196098 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 156.49sec 0 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish unstable_affliction 30108 0 0 0.00 0 0 46.1 0.0 0.0% 0.0% 0.0% 0.0% 6.48sec 0 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish unstable_affliction_1 ticks -233490 56803792 189346 19.35 347882 928684 0.0 96.8 41.2% 0.0% 0.0% 0.0% 0.00sec 56803792 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish unstable_affliction_2 ticks -233496 44221081 147404 14.18 368619 978973 0.0 70.9 41.8% 0.0% 0.0% 0.0% 0.00sec 44221081 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish unstable_affliction_3 ticks -233497 24552635 81842 7.62 380285 1010062 0.0 38.1 41.9% 0.0% 0.0% 0.0% 0.00sec 24552635 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish unstable_affliction_4 ticks -233498 1640709 5469 0.56 351492 929863 0.0 2.8 41.0% 0.0% 0.0% 0.0% 0.00sec 1640709 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish unstable_affliction_5 ticks -233499 249790 833 0.09 333961 888231 0.0 0.4 40.0% 0.0% 0.0% 0.0% 0.00sec 249790 300.01sec
Kiljadens_Burning_Wish Kiljadens_Burning_Wish_doomguard doom_bolt 85692 23478087 78258 23.73 161161 322348 119.4 118.6 22.8% 0.0% 0.0% 0.0% 2.50sec 23478087 300.01sec
Norgannons_Foresight Norgannons_Foresight agony ticks -980 40233600 134112 38.59 142782 377957 17.3 193.0 27.9% 0.0% 0.0% 0.0% 18.10sec 40233600 300.01sec
Norgannons_Foresight Norgannons_Foresight augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Norgannons_Foresight Norgannons_Foresight compounding_horror 231489 1930780 6436 5.15 61892 123881 25.7 25.7 21.1% 0.0% 0.0% 0.0% 11.47sec 1930780 300.01sec
Norgannons_Foresight Norgannons_Foresight corruption ticks -172 35191480 117305 38.50 125188 330725 21.9 192.5 28.0% 0.0% 0.0% 0.0% 13.85sec 35191480 300.01sec
Norgannons_Foresight Norgannons_Foresight drain_soul ticks -198590 35325003 117750 44.44 123429 249268 65.2 222.2 28.3% 0.0% 0.0% 0.0% 4.56sec 35325003 300.01sec
Norgannons_Foresight Norgannons_Foresight flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Norgannons_Foresight Norgannons_Foresight food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Norgannons_Foresight Norgannons_Foresight harvester_of_souls 218615 7334544 24448 10.10 120023 240005 50.7 50.5 21.0% 0.0% 0.0% 0.0% 5.79sec 7334544 300.01sec
Norgannons_Foresight Norgannons_Foresight life_tap 1454 0 0 0.00 0 0 11.4 0.0 0.0% 0.0% 0.0% 0.0% 22.77sec 0 300.01sec
Norgannons_Foresight Norgannons_Foresight potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Norgannons_Foresight Norgannons_Foresight reap_souls 216698 0 0 0.00 0 0 12.4 0.0 0.0% 0.0% 0.0% 0.0% 24.91sec 0 300.01sec
Norgannons_Foresight Norgannons_Foresight rend_soul 242834 5614702 18715 3.27 284722 568931 16.3 16.3 20.8% 0.0% 0.0% 0.0% 17.16sec 5614702 300.01sec
Norgannons_Foresight Norgannons_Foresight soul_harvest 196098 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 153.15sec 0 300.01sec
Norgannons_Foresight Norgannons_Foresight summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Norgannons_Foresight Norgannons_Foresight unstable_affliction 30108 0 0 0.00 0 0 47.8 0.0 0.0% 0.0% 0.0% 0.0% 6.24sec 0 300.01sec
Norgannons_Foresight Norgannons_Foresight unstable_affliction_1 ticks -233490 56762449 189208 21.94 311772 833640 0.0 109.7 39.4% 0.0% 0.0% 0.0% 0.00sec 56762449 300.01sec
Norgannons_Foresight Norgannons_Foresight unstable_affliction_2 ticks -233496 44617415 148725 16.22 330643 879336 0.0 81.1 40.0% 0.0% 0.0% 0.0% 0.00sec 44617415 300.01sec
Norgannons_Foresight Norgannons_Foresight unstable_affliction_3 ticks -233497 24918610 83062 8.80 339447 903640 0.0 44.0 40.2% 0.0% 0.0% 0.0% 0.00sec 24918610 300.01sec
Norgannons_Foresight Norgannons_Foresight unstable_affliction_4 ticks -233498 1655227 5517 0.63 314202 834319 0.0 3.2 40.5% 0.0% 0.0% 0.0% 0.00sec 1655227 300.01sec
Norgannons_Foresight Norgannons_Foresight unstable_affliction_5 ticks -233499 268986 897 0.11 295206 808390 0.0 0.5 40.2% 0.0% 0.0% 0.0% 0.00sec 268986 300.01sec
Norgannons_Foresight Norgannons_Foresight_doomguard doom_bolt 85692 23882208 79605 24.61 160381 320856 123.9 123.1 21.0% 0.0% 0.0% 0.0% 2.41sec 23882208 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal agony ticks -980 40516282 135054 37.74 141621 374310 17.3 188.7 31.4% 0.0% 0.0% 0.0% 18.09sec 40516282 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal compounding_horror 231489 1933054 6443 5.00 62213 124094 25.0 25.0 24.4% 0.0% 0.0% 0.0% 11.80sec 1933054 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal corruption ticks -172 35412482 118042 37.64 124124 327630 21.9 188.2 31.5% 0.0% 0.0% 0.0% 13.85sec 35412482 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal drain_soul ticks -198590 35533492 118445 43.34 123959 250360 64.0 216.7 31.7% 0.0% 0.0% 0.0% 4.64sec 35533492 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal harvester_of_souls 218615 7391047 24636 9.84 120720 241244 49.4 49.2 24.5% 0.0% 0.0% 0.0% 5.94sec 7391047 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal life_tap 1454 0 0 0.00 0 0 11.1 0.0 0.0% 0.0% 0.0% 0.0% 23.26sec 0 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal reap_souls 216698 0 0 0.00 0 0 12.5 0.0 0.0% 0.0% 0.0% 0.0% 24.92sec 0 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal rend_soul 242834 5620361 18734 3.16 285988 572905 15.8 15.8 24.2% 0.0% 0.0% 0.0% 17.63sec 5620361 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal soul_harvest 196098 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 154.84sec 0 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal unstable_affliction 30108 0 0 0.00 0 0 46.7 0.0 0.0% 0.0% 0.0% 0.0% 6.39sec 0 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal unstable_affliction_1 ticks -233490 57236280 190788 21.57 309511 826288 0.0 107.8 42.8% 0.0% 0.0% 0.0% 0.00sec 57236280 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal unstable_affliction_2 ticks -233496 44672443 148908 15.83 328373 872343 0.0 79.1 43.4% 0.0% 0.0% 0.0% 0.00sec 44672443 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal unstable_affliction_3 ticks -233497 24887436 82958 8.57 337420 895993 0.0 42.9 43.6% 0.0% 0.0% 0.0% 0.00sec 24887436 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal unstable_affliction_4 ticks -233498 1627814 5426 0.61 309474 830459 0.0 3.0 43.3% 0.0% 0.0% 0.0% 0.00sec 1627814 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal unstable_affliction_5 ticks -233499 261744 872 0.10 298051 788862 0.0 0.5 42.7% 0.0% 0.0% 0.0% 0.00sec 261744 300.01sec
Pillars_of_the_Dark_Portal Pillars_of_the_Dark_Portal_doomguard doom_bolt 85692 24161154 80534 24.10 161121 322136 121.3 120.5 24.5% 0.0% 0.0% 0.0% 2.46sec 24161154 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris agony ticks -980 39335110 131117 38.04 138745 366590 17.3 190.2 29.9% 0.0% 0.0% 0.0% 17.96sec 39335110 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris compounding_horror 231489 2072996 6910 6.24 54122 108508 31.2 31.2 22.6% 0.0% 0.0% 0.0% 9.44sec 2072996 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris corruption ticks -172 34391166 114637 37.94 121729 320962 21.9 189.7 29.9% 0.0% 0.0% 0.0% 13.85sec 34391166 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris drain_soul ticks -198590 33920070 113067 41.51 125082 252541 64.3 207.5 30.1% 0.0% 0.0% 0.0% 4.61sec 33920070 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris harvester_of_souls 218615 7381839 24605 9.83 122224 244674 49.4 49.1 22.9% 0.0% 0.0% 0.0% 5.97sec 7381839 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris life_tap 1454 0 0 0.00 0 0 10.1 0.0 0.0% 0.0% 0.0% 0.0% 24.78sec 0 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris reap_souls 216698 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.21sec 0 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris rend_soul 242834 5301347 17671 2.98 289500 577930 14.9 14.9 22.8% 0.0% 0.0% 0.0% 18.49sec 5301347 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris soul_harvest 196098 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 156.89sec 0 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris unstable_affliction 30108 0 0 0.00 0 0 54.6 0.0 0.0% 0.0% 0.0% 0.0% 5.45sec 0 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris unstable_affliction_1 ticks -233490 68167397 227225 27.84 292179 777906 0.0 139.2 40.7% 0.0% 0.0% 0.0% 0.00sec 68167397 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris unstable_affliction_2 ticks -233496 43221344 144071 16.52 309129 824959 0.0 82.6 41.5% 0.0% 0.0% 0.0% 0.00sec 43221344 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris unstable_affliction_3 ticks -233497 24108299 80361 8.81 322847 857753 0.0 44.1 41.9% 0.0% 0.0% 0.0% 0.00sec 24108299 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris unstable_affliction_4 ticks -233498 2654642 8849 1.05 300123 796780 0.0 5.2 41.6% 0.0% 0.0% 0.0% 0.00sec 2654642 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris unstable_affliction_5 ticks -233499 334528 1115 0.14 287556 770713 0.0 0.7 41.5% 0.0% 0.0% 0.0% 0.00sec 334528 300.01sec
Power_Cord_of_Lethtendris Power_Cord_of_Lethtendris_doomguard doom_bolt 85692 23903428 79675 24.28 160172 320515 122.2 121.4 22.9% 0.0% 0.0% 0.0% 2.44sec 23903428 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus agony ticks -980 40723219 135744 39.19 142049 376613 17.3 195.9 28.0% 0.0% 0.0% 0.0% 18.11sec 40723219 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus compounding_horror 231489 1941072 6470 5.21 61535 122758 26.1 26.1 21.1% 0.0% 0.0% 0.0% 11.34sec 1941072 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus corruption ticks -172 35565525 118552 39.08 124617 329538 21.9 195.4 28.0% 0.0% 0.0% 0.0% 13.85sec 35565525 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus drain_soul ticks -198590 35592207 118641 45.23 122088 246434 66.1 226.1 28.4% 0.0% 0.0% 0.0% 4.49sec 35592207 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus harvester_of_souls 218615 7378026 24593 10.26 118693 237440 51.6 51.3 21.1% 0.0% 0.0% 0.0% 5.72sec 7378026 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus life_tap 1454 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 22.43sec 0 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus reap_souls 216698 0 0 0.00 0 0 12.5 0.0 0.0% 0.0% 0.0% 0.0% 24.53sec 0 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus rend_soul 242834 5682530 18941 3.33 281735 563285 16.7 16.7 21.1% 0.0% 0.0% 0.0% 16.86sec 5682530 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus soul_harvest 196098 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 154.67sec 0 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus unstable_affliction 30108 0 0 0.00 0 0 48.5 0.0 0.0% 0.0% 0.0% 0.0% 6.16sec 0 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus unstable_affliction_1 ticks -233490 57233867 190780 22.24 310630 827253 0.0 111.2 39.5% 0.0% 0.0% 0.0% 0.00sec 57233867 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus unstable_affliction_2 ticks -233496 45195674 150652 16.50 328928 875747 0.0 82.5 40.1% 0.0% 0.0% 0.0% 0.00sec 45195674 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus unstable_affliction_3 ticks -233497 25158177 83861 8.94 338546 898148 0.0 44.7 40.1% 0.0% 0.0% 0.0% 0.00sec 25158177 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus unstable_affliction_4 ticks -233498 1710662 5702 0.65 310090 834169 0.0 3.3 40.8% 0.0% 0.0% 0.0% 0.00sec 1710662 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus unstable_affliction_5 ticks -233499 283486 945 0.11 300329 802398 0.0 0.6 39.1% 0.0% 0.0% 0.0% 0.00sec 283486 300.01sec
Prydaz_Xavarics_Magnum_Opus Prydaz_Xavarics_Magnum_Opus_doomguard doom_bolt 85692 24001419 80002 24.99 158637 317170 125.8 125.0 21.1% 0.0% 0.0% 0.0% 2.37sec 24001419 300.01sec
Reap_and_Sow Reap_and_Sow agony ticks -980 41528420 138428 37.89 148112 392203 17.3 189.4 29.1% 0.0% 0.0% 0.0% 18.09sec 41528420 300.01sec
Reap_and_Sow Reap_and_Sow augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Reap_and_Sow Reap_and_Sow compounding_horror 231489 2145333 7151 5.30 66403 133496 26.5 26.5 21.6% 0.0% 0.0% 0.0% 11.10sec 2145333 300.01sec
Reap_and_Sow Reap_and_Sow corruption ticks -172 36158616 120529 37.81 129308 341802 21.9 189.0 29.2% 0.0% 0.0% 0.0% 13.85sec 36158616 300.01sec
Reap_and_Sow Reap_and_Sow drain_soul ticks -198590 35816205 119387 43.57 126939 254773 64.0 217.8 29.3% 0.0% 0.0% 0.0% 4.63sec 35816205 300.01sec
Reap_and_Sow Reap_and_Sow flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Reap_and_Sow Reap_and_Sow food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Reap_and_Sow Reap_and_Sow harvester_of_souls 218615 7891281 26303 10.67 121538 243160 53.6 53.3 21.7% 0.0% 0.0% 0.0% 5.48sec 7891281 300.01sec
Reap_and_Sow Reap_and_Sow life_tap 1454 0 0 0.00 0 0 11.2 0.0 0.0% 0.0% 0.0% 0.0% 23.11sec 0 300.01sec
Reap_and_Sow Reap_and_Sow potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Reap_and_Sow Reap_and_Sow reap_souls 216698 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 38.36sec 0 300.01sec
Reap_and_Sow Reap_and_Sow rend_soul 242834 5880844 19602 3.36 287113 574986 16.8 16.8 21.7% 0.0% 0.0% 0.0% 16.81sec 5880844 300.01sec
Reap_and_Sow Reap_and_Sow soul_harvest 196098 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 155.92sec 0 300.01sec
Reap_and_Sow Reap_and_Sow summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Reap_and_Sow Reap_and_Sow unstable_affliction 30108 0 0 0.00 0 0 46.9 0.0 0.0% 0.0% 0.0% 0.0% 6.39sec 0 300.01sec
Reap_and_Sow Reap_and_Sow unstable_affliction_1 ticks -233490 57603555 192012 21.72 316379 839223 0.0 108.6 40.9% 0.0% 0.0% 0.0% 0.00sec 57603555 300.01sec
Reap_and_Sow Reap_and_Sow unstable_affliction_2 ticks -233496 44590366 148635 15.99 332420 879288 0.0 79.9 41.2% 0.0% 0.0% 0.0% 0.00sec 44590366 300.01sec
Reap_and_Sow Reap_and_Sow unstable_affliction_3 ticks -233497 24632305 82108 8.57 341466 904730 0.0 42.8 41.4% 0.0% 0.0% 0.0% 0.00sec 24632305 300.01sec
Reap_and_Sow Reap_and_Sow unstable_affliction_4 ticks -233498 1687115 5624 0.63 316448 842328 0.0 3.2 41.1% 0.0% 0.0% 0.0% 0.00sec 1687115 300.01sec
Reap_and_Sow Reap_and_Sow unstable_affliction_5 ticks -233499 260429 868 0.10 306109 797538 0.0 0.5 40.2% 0.0% 0.0% 0.0% 0.00sec 260429 300.01sec
Reap_and_Sow Reap_and_Sow_doomguard doom_bolt 85692 23950723 79833 24.20 162816 325460 121.8 121.0 21.6% 0.0% 0.0% 0.0% 2.45sec 23950723 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike agony ticks -980 40207689 134026 37.84 145401 385229 17.3 189.2 28.0% 0.0% 0.0% 0.0% 18.09sec 40207689 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike compounding_horror 231489 1848295 6161 5.04 60693 121564 25.2 25.2 20.9% 0.0% 0.0% 0.0% 11.82sec 1848295 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike corruption ticks -172 40375944 134586 37.76 146565 387178 21.9 188.8 28.0% 0.0% 0.0% 0.0% 13.85sec 40375944 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike drain_soul ticks -198590 34084227 113614 43.43 121908 246314 64.1 217.1 28.2% 0.0% 0.0% 0.0% 4.64sec 34084227 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike harvester_of_souls 218615 7065509 23551 9.86 118548 236899 49.6 49.3 20.9% 0.0% 0.0% 0.0% 6.00sec 7065509 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike life_tap 1454 0 0 0.00 0 0 11.1 0.0 0.0% 0.0% 0.0% 0.0% 23.29sec 0 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike reap_souls 216698 0 0 0.00 0 0 12.4 0.0 0.0% 0.0% 0.0% 0.0% 24.64sec 0 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike rend_soul 242834 5400967 18003 3.17 281534 562627 15.8 15.8 21.1% 0.0% 0.0% 0.0% 17.87sec 5400967 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike soul_harvest 196098 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 154.24sec 0 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike unstable_affliction 30108 0 0 0.00 0 0 47.0 0.0 0.0% 0.0% 0.0% 0.0% 6.35sec 0 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike unstable_affliction_1 ticks -233490 56876644 189589 21.61 317600 848024 0.0 108.0 39.4% 0.0% 0.0% 0.0% 0.00sec 56876644 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike unstable_affliction_2 ticks -233496 44564524 148548 15.90 336930 895627 0.0 79.5 40.0% 0.0% 0.0% 0.0% 0.00sec 44564524 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike unstable_affliction_3 ticks -233497 25002607 83342 8.70 345994 918324 0.0 43.5 40.0% 0.0% 0.0% 0.0% 0.00sec 25002607 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike unstable_affliction_4 ticks -233498 1676223 5587 0.63 319495 847605 0.0 3.2 39.7% 0.0% 0.0% 0.0% 0.00sec 1676223 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike unstable_affliction_5 ticks -233499 270487 902 0.11 305891 807349 0.0 0.5 39.4% 0.0% 0.0% 0.0% 0.00sec 270487 300.01sec
Sacrolashs_Dark_Strike Sacrolashs_Dark_Strike_doomguard doom_bolt 85692 23143649 77143 24.16 158331 316593 121.6 120.8 21.0% 0.0% 0.0% 0.0% 2.46sec 23143649 300.01sec
Sephuzs_Secret Sephuzs_Secret agony ticks -980 40474737 134916 39.63 136380 361256 17.3 198.2 30.2% 0.0% 0.0% 0.0% 18.09sec 40474737 300.01sec
Sephuzs_Secret Sephuzs_Secret augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sephuzs_Secret Sephuzs_Secret compounding_horror 231489 2005486 6685 5.28 61823 122509 26.4 26.4 23.2% 0.0% 0.0% 0.0% 11.18sec 2005486 300.01sec
Sephuzs_Secret Sephuzs_Secret corruption ticks -172 35348297 117828 39.51 119632 315792 21.9 197.6 30.2% 0.0% 0.0% 0.0% 13.85sec 35348297 300.01sec
Sephuzs_Secret Sephuzs_Secret drain_soul ticks -198590 36603357 122011 45.79 122126 246281 67.0 229.0 30.4% 0.0% 0.0% 0.0% 4.44sec 36603357 300.01sec
Sephuzs_Secret Sephuzs_Secret flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sephuzs_Secret Sephuzs_Secret food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sephuzs_Secret Sephuzs_Secret harvester_of_souls 218615 7595358 25317 10.39 118681 237501 52.2 52.0 23.1% 0.0% 0.0% 0.0% 5.65sec 7595358 300.01sec
Sephuzs_Secret Sephuzs_Secret life_tap 1454 0 0 0.00 0 0 11.7 0.0 0.0% 0.0% 0.0% 0.0% 22.24sec 0 300.01sec
Sephuzs_Secret Sephuzs_Secret potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sephuzs_Secret Sephuzs_Secret reap_souls 216698 0 0 0.00 0 0 12.5 0.0 0.0% 0.0% 0.0% 0.0% 24.66sec 0 300.01sec
Sephuzs_Secret Sephuzs_Secret rend_soul 242834 5800150 19333 3.35 281380 563700 16.7 16.7 23.1% 0.0% 0.0% 0.0% 16.85sec 5800150 300.01sec
Sephuzs_Secret Sephuzs_Secret soul_harvest 196098 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 152.73sec 0 300.01sec
Sephuzs_Secret Sephuzs_Secret summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sephuzs_Secret Sephuzs_Secret unstable_affliction 30108 0 0 0.00 0 0 49.0 0.0 0.0% 0.0% 0.0% 0.0% 6.08sec 0 300.01sec
Sephuzs_Secret Sephuzs_Secret unstable_affliction_1 ticks -233490 56462936 188210 22.39 298278 792987 0.0 111.9 41.7% 0.0% 0.0% 0.0% 0.00sec 56462936 300.01sec
Sephuzs_Secret Sephuzs_Secret unstable_affliction_2 ticks -233496 44790718 149302 16.68 315631 839480 0.0 83.4 42.3% 0.0% 0.0% 0.0% 0.00sec 44790718 300.01sec
Sephuzs_Secret Sephuzs_Secret unstable_affliction_3 ticks -233497 24969819 83233 9.07 325192 860648 0.0 45.3 42.1% 0.0% 0.0% 0.0% 0.00sec 24969819 300.01sec
Sephuzs_Secret Sephuzs_Secret unstable_affliction_4 ticks -233498 1640198 5467 0.65 297717 795174 0.0 3.2 41.9% 0.0% 0.0% 0.0% 0.00sec 1640198 300.01sec
Sephuzs_Secret Sephuzs_Secret unstable_affliction_5 ticks -233499 277058 924 0.11 282759 751716 0.0 0.6 43.7% 0.0% 0.0% 0.0% 0.00sec 277058 300.01sec
Sephuzs_Secret Sephuzs_Secret_doomguard doom_bolt 85692 24679457 82262 25.26 158687 317309 127.1 126.3 23.2% 0.0% 0.0% 0.0% 2.35sec 24679457 300.01sec
Sindorei_Spite Sindorei_Spite agony ticks -980 40219086 134064 38.16 141659 375707 17.3 190.8 29.5% 0.0% 0.0% 0.0% 18.09sec 40219086 300.01sec
Sindorei_Spite Sindorei_Spite augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sindorei_Spite Sindorei_Spite compounding_horror 231489 1957750 6526 5.02 63605 127268 25.1 25.1 22.6% 0.0% 0.0% 0.0% 11.78sec 1957750 300.01sec
Sindorei_Spite Sindorei_Spite corruption ticks -172 35208323 117361 38.09 124481 328758 21.9 190.5 29.6% 0.0% 0.0% 0.0% 13.85sec 35208323 300.01sec
Sindorei_Spite Sindorei_Spite drain_soul ticks -198590 36223418 120745 43.91 126600 255681 64.8 219.6 29.7% 0.0% 0.0% 0.0% 4.59sec 36223418 300.01sec
Sindorei_Spite Sindorei_Spite flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sindorei_Spite Sindorei_Spite food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sindorei_Spite Sindorei_Spite harvester_of_souls 218615 7485340 24950 9.94 123139 246046 49.9 49.7 22.3% 0.0% 0.0% 0.0% 5.87sec 7485340 300.01sec
Sindorei_Spite Sindorei_Spite life_tap 1454 0 0 0.00 0 0 11.3 0.0 0.0% 0.0% 0.0% 0.0% 23.02sec 0 300.01sec
Sindorei_Spite Sindorei_Spite potion 0 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sindorei_Spite Sindorei_Spite reap_souls 216698 0 0 0.00 0 0 12.3 0.0 0.0% 0.0% 0.0% 0.0% 25.21sec 0 300.01sec
Sindorei_Spite Sindorei_Spite rend_soul 242834 5753714 19178 3.21 292219 585930 16.1 16.1 22.4% 0.0% 0.0% 0.0% 17.55sec 5753714 300.01sec
Sindorei_Spite Sindorei_Spite soul_harvest 196098 0 0 0.00 0 0 2.2 0.0 0.0% 0.0% 0.0% 0.0% 159.00sec 0 300.01sec
Sindorei_Spite Sindorei_Spite summon_doomguard 18540 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Sindorei_Spite Sindorei_Spite unstable_affliction 30108 0 0 0.00 0 0 46.2 0.0 0.0% 0.0% 0.0% 0.0% 6.48sec 0 300.01sec
Sindorei_Spite Sindorei_Spite unstable_affliction_1 ticks -233490 56795060 189317 21.67 311392 830645 0.0 108.4 41.0% 0.0% 0.0% 0.0% 0.00sec 56795060 300.01sec
Sindorei_Spite Sindorei_Spite unstable_affliction_2 ticks -233496 43594404 145315 15.54 331488 883098 0.0 77.7 41.6% 0.0% 0.0% 0.0% 0.00sec 43594404 300.01sec
Sindorei_Spite Sindorei_Spite unstable_affliction_3 ticks -233497 23906680 79689 8.21 344252 917329 0.0 41.1 41.5% 0.0% 0.0% 0.0% 0.00sec 23906680 300.01sec
Sindorei_Spite Sindorei_Spite unstable_affliction_4 ticks -233498 1507125 5024 0.58 309663 824316 0.0 2.9 41.3% 0.0% 0.0% 0.0% 0.00sec 1507125 300.01sec
Sindorei_Spite Sindorei_Spite unstable_affliction_5 ticks -233499 230150 767 0.09 294043 791328 0.0 0.5 42.6% 0.0% 0.0% 0.0% 0.00sec 230150 300.01sec
Sindorei_Spite Sindorei_Spite_doomguard doom_bolt 85692 24535312 81782 24.37 164374 328725 122.6 121.8 22.5% 0.0% 0.0% 0.0% 2.43sec 24535312 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles agony ticks -980 40524610 135082 38.39 144762 383536 17.3 192.0 27.8% 0.0% 0.0% 0.0% 18.10sec 40524610 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles compounding_horror 231489 1921170 6404 5.10 62370 124855 25.5 25.5 20.7% 0.0% 0.0% 0.0% 11.53sec 1921170 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles corruption ticks -172 35439626 118132 38.31 126946 335903 21.9 191.5 27.8% 0.0% 0.0% 0.0% 13.85sec 35439626 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles drain_soul ticks -198590 36120651 120402 44.20 127063 256573 64.9 221.0 28.1% 0.0% 0.0% 0.0% 4.57sec 36120651 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles harvester_of_souls 218615 7458372 24860 10.03 123366 246197 50.4 50.1 20.7% 0.0% 0.0% 0.0% 5.81sec 7458372 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles life_tap 1454 0 0 0.00 0 0 11.3 0.0 0.0% 0.0% 0.0% 0.0% 22.90sec 0 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles reap_souls 216698 0 0 0.00 0 0 12.5 0.0 0.0% 0.0% 0.0% 0.0% 24.73sec 0 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles rend_soul 242834 5699610 18998 3.21 293221 587993 16.1 16.1 20.9% 0.0% 0.0% 0.0% 17.39sec 5699610 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles soul_harvest 196098 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 154.72sec 0 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles unstable_affliction 30108 0 0 0.00 0 0 47.5 0.0 0.0% 0.0% 0.0% 0.0% 6.28sec 0 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles unstable_affliction_1 ticks -233490 57856683 192856 21.88 319309 854494 0.0 109.4 39.2% 0.0% 0.0% 0.0% 0.00sec 57856683 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles unstable_affliction_2 ticks -233496 45317038 151057 16.09 339319 902981 0.0 80.4 39.8% 0.0% 0.0% 0.0% 0.00sec 45317038 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles unstable_affliction_3 ticks -233497 25338350 84461 8.75 348103 928204 0.0 43.7 39.8% 0.0% 0.0% 0.0% 0.00sec 25338350 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles unstable_affliction_4 ticks -233498 1605159 5351 0.61 320732 845635 0.0 3.1 39.0% 0.0% 0.0% 0.0% 0.00sec 1605159 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles unstable_affliction_5 ticks -233499 268155 894 0.11 307772 812016 0.0 0.5 38.6% 0.0% 0.0% 0.0% 0.00sec 268155 300.01sec
Stretens_Sleepless_Shackles Stretens_Sleepless_Shackles_doomguard doom_bolt 85692 23680322 78932 24.50 160026 320124 123.3 122.5 20.8% 0.0% 0.0% 0.0% 2.42sec 23680322 300.01sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.38% 11.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.70% 10.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.70% 10.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.69% 10.69% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.69%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.42% 10.42% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.78% 10.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.78%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.98% 10.98% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.09% 10.09% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.67% 7.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.67%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.58% 6.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.58%

Trigger Attempt Success

  • trigger_pct:100.00%
Agony 1.0 188.2 1.8sec 1.6sec 99.40% 99.40% 192.0(192.0) 0.0

Buff details

  • buff initial source:Baseline
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.43%
  • agony_2:0.43%
  • agony_3:0.42%
  • agony_4:0.42%
  • agony_5:0.42%
  • agony_6:97.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Agony 1.0 201.5 1.7sec 1.5sec 99.44% 99.44% 196.5(196.5) 0.0

Buff details

  • buff initial source:Hood_of_Eternal_Disdain
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.40%
  • agony_2:0.40%
  • agony_3:0.40%
  • agony_4:0.39%
  • agony_5:0.39%
  • agony_6:97.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Agony 1.0 188.4 1.8sec 1.6sec 99.40% 99.40% 192.1(192.1) 0.0

Buff details

  • buff initial source:Reap_and_Sow
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.43%
  • agony_2:0.43%
  • agony_3:0.42%
  • agony_4:0.42%
  • agony_5:0.41%
  • agony_6:97.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Agony 1.0 189.2 1.8sec 1.6sec 99.40% 99.40% 192.9(192.9) 0.0

Buff details

  • buff initial source:Power_Cord_of_Lethtendris
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.43%
  • agony_2:0.43%
  • agony_3:0.42%
  • agony_4:0.42%
  • agony_5:0.41%
  • agony_6:97.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Agony 1.0 191.0 1.7sec 1.6sec 99.41% 99.41% 194.7(194.7) 0.0

Buff details

  • buff initial source:Stretens_Sleepless_Shackles
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.43%
  • agony_2:0.42%
  • agony_3:0.42%
  • agony_4:0.42%
  • agony_5:0.41%
  • agony_6:97.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Agony 1.0 194.9 1.7sec 1.5sec 99.42% 99.42% 192.6(192.6) 0.0

Buff details

  • buff initial source:Prydaz_Xavarics_Magnum_Opus
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.42%
  • agony_2:0.41%
  • agony_3:0.41%
  • agony_4:0.41%
  • agony_5:0.40%
  • agony_6:97.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Agony 1.0 188.2 1.8sec 1.6sec 99.40% 99.40% 192.0(192.0) 0.0

Buff details

  • buff initial source:Sacrolashs_Dark_Strike
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.43%
  • agony_2:0.43%
  • agony_3:0.42%
  • agony_4:0.42%
  • agony_5:0.42%
  • agony_6:97.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Agony 1.0 197.2 1.7sec 1.5sec 99.43% 99.43% 194.8(194.8) 0.0

Buff details

  • buff initial source:Sephuzs_Secret
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.41%
  • agony_2:0.41%
  • agony_3:0.40%
  • agony_4:0.40%
  • agony_5:0.40%
  • agony_6:97.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Agony 1.0 192.0 1.7sec 1.5sec 99.41% 99.41% 193.0(193.0) 0.0

Buff details

  • buff initial source:Norgannons_Foresight
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.42%
  • agony_2:0.42%
  • agony_3:0.42%
  • agony_4:0.41%
  • agony_5:0.41%
  • agony_6:97.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Agony 1.0 187.7 1.8sec 1.6sec 99.40% 99.40% 193.0(193.0) 0.0

Buff details

  • buff initial source:Pillars_of_the_Dark_Portal
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.43%
  • agony_2:0.43%
  • agony_3:0.42%
  • agony_4:0.42%
  • agony_5:0.42%
  • agony_6:97.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Agony 1.0 184.7 1.8sec 1.6sec 99.41% 99.41% 191.1(191.1) 0.0

Buff details

  • buff initial source:Kiljadens_Burning_Wish
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.44%
  • agony_2:0.44%
  • agony_3:0.43%
  • agony_4:0.43%
  • agony_5:0.43%
  • agony_6:97.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Agony 1.0 189.8 1.8sec 1.6sec 99.41% 99.41% 193.6(193.6) 0.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.43%
  • agony_2:0.43%
  • agony_3:0.42%
  • agony_4:0.42%
  • agony_5:0.42%
  • agony_6:97.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Agony 1.0 191.9 1.7sec 1.5sec 99.41% 99.41% 192.9(192.9) 0.0

Buff details

  • buff initial source:Celumbra_the_Nights_Dichotomy
  • cooldown name:buff_agony
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.42%
  • agony_2:0.42%
  • agony_3:0.42%
  • agony_4:0.41%
  • agony_5:0.41%
  • agony_6:97.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 11913553.05
Combat End Resource Mean Min Max
Health 34248737.31 0.00 317833091.93

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 4999
Mean 300.01
Minimum 240.05
Maximum 359.99
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 4999
Mean 12131809.67
Minimum 11241123.45
Maximum 13065697.77
Spread ( max - min ) 1824574.32
Range [ ( max - min ) / 2 * 100% ] 7.52%
Standard Deviation 226099.7185
5th Percentile 11781920.86
95th Percentile 12519212.16
( 95th Percentile - 5th Percentile ) 737291.30
Mean Distribution
Standard Deviation 3197.8527
95.00% Confidence Intervall ( 12125542.00 - 12138077.35 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1335
0.1 Scale Factor Error with Delta=300 436398965
0.05 Scale Factor Error with Delta=300 1745595860
0.01 Scale Factor Error with Delta=300 43639896497
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 4377306792 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.